Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_1295 [new locus tag: SP70585_RS06445 ]
- pan locus tag?: PNEUPAN002483000
- symbol: SP70585_1295
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_1295 [new locus tag: SP70585_RS06445 ]
- symbol: SP70585_1295
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1198869..1199120
- length: 252
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000918 (1198869..1199120) NCBI
- BioCyc: see SP70585_RS06445
- MicrobesOnline: 7477225 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTTAATAAAGAATCGAAAAGTAGACTGAAAATAATAAAGCAAGATACTGGTGCAATT
GTATTCGACAAAAATCAAGGGATATACTTTCAAACAAATGATGTAGGTGTCAAAATTTTA
GAGTTACTATCTAAAAATGAAAGCGAAGAAGAAATTGTTAGCGCTATATCTGTTGCGTAT
TCCATTGAAATCGATGTTGCAAAACAAGATGTTAAAGATTTTATACAATCTCTAAAAAAA
GGAGGGCTATAG60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_1295 [new locus tag: SP70585_RS06445 ]
- symbol: SP70585_1295
- description: hypothetical protein
- length: 83
- theoretical pI: 5.11055
- theoretical MW: 9294.59
- GRAVY: -0.23253
⊟Function[edit | edit source]
- TIGRFAM: SynChlorMet cassette protein ScmD (TIGR04248; HMM-score: 26.3)GeoRSP system PqqD family protein (TIGR04302; HMM-score: 22.5)and 3 morePqqD family protein, HPr-rel-A system (TIGR04353; HMM-score: 19.9)Biosynthesis of cofactors, prosthetic groups, and carriers Other coenzyme PQQ biosynthesis protein PqqD (TIGR03859; HMM-score: 17)sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 14.4)
- TheSEED:
- PFAM: HTH (CL0123) PqqD; Coenzyme PQQ synthesis protein D (PqqD) (PF05402; HMM-score: 42.4)and 4 moreTypeIII_Chap (CL0097) Chaperone_III; Type III secretion chaperone domain (PF07824; HMM-score: 14)no clan defined RXLR_WY; RXLR phytopathogen effector protein WY-domain (PF18634; HMM-score: 13.7)DUF2119; Uncharacterized protein conserved in archaea (DUF2119) (PF09892; HMM-score: 13.5)Saposin_like (CL0707) SapB_1; Saposin-like type B, region 1 (PF05184; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9819
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0165
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001763
- TAT(Tat/SPI): 0.000101
- LIPO(Sec/SPII): 0.000194
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFNKESKSRLKIIKQDTGAIVFDKNQGIYFQTNDVGVKILELLSKNESEEEIVSAISVAYSIEIDVAKQDVKDFIQSLKKGGL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]