Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_1815 [new locus tag: SP70585_RS09015 ]
- pan locus tag?: PNEUPAN003223000
- symbol: SP70585_1815
- pan gene symbol?: —
- synonym:
- product: putative glycosyltransferase YibD
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_1815 [new locus tag: SP70585_RS09015 ]
- symbol: SP70585_1815
- product: putative glycosyltransferase YibD
- replicon: chromosome
- strand: -
- coordinates: 1687281..1687640
- length: 360
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000918 (1687281..1687640) NCBI
- BioCyc: see SP70585_RS09015
- MicrobesOnline: 7477735 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGGATGATAAAATTACGGTCATTGTACCAGTATACAATGTAGAAAACTATCTGAGGAAA
TGTCTAGATAGTATCATTTCTCAAACATATAAAAATATTGAGATTGTTGTCGTTAATAAT
GGTTCTACGGATGCTTCAGGTGAAATTTGTAAAGAATTTTCAGAAATGGATCACCGAATT
CTCTATATAGAACAAGAAAATGCTGGTATTTCTGCCGCACGAAACACCGGTCTGAATAAT
ATGTCCGGAAATTATGTGACCTTTGTGGATTCAGATGATTGGATTGAGTTAGATTATGTA
GAAACCCTATATAAAAAAATAACAGAATATCAAGCTGATATTGCAGTTGGGAATTACTAG60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_1815 [new locus tag: SP70585_RS09015 ]
- symbol: SP70585_1815
- description: putative glycosyltransferase YibD
- length: 119
- theoretical pI: 4.02377
- theoretical MW: 13534
- GRAVY: -0.272269
⊟Function[edit | edit source]
- reaction: EC 2.-.-.-? ExPASy
- TIGRFAM: poly-beta-1,6 N-acetyl-D-glucosamine synthase (TIGR03937; EC 2.4.1.-; HMM-score: 66.8)putative glycosyltransferase, exosortase G-associated (TIGR03111; HMM-score: 64)mycofactocin system glycosyltransferase (TIGR03965; HMM-score: 58.6)and 11 morechitooligosaccharide synthase NodC (TIGR04242; EC 2.4.1.-; HMM-score: 50.2)Unknown function Enzymes of unknown specificity transferase 2, rSAM/selenodomain-associated (TIGR04283; EC 2.-.-.-; HMM-score: 41.8)colanic acid biosynthesis glycosyltransferase WcaA (TIGR04017; EC 2.4.-.-; HMM-score: 37.3)glycosyltransferase, TIGR04182 family (TIGR04182; HMM-score: 32)hopene-associated glycosyltransferase HpnB (TIGR03469; HMM-score: 28.1)peptide S-glycosyltransferase, SunS family (TIGR04195; EC 2.4.1.-; HMM-score: 28.1)colanic acid biosynthesis glycosyltransferase WcaE (TIGR04009; EC 2.4.-.-; HMM-score: 25.3)glycosyltransferase domain (TIGR04440; EC 2.-.-.-; HMM-score: 24.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides rhamnosyltransferase (TIGR01556; EC 2.4.1.-; HMM-score: 23.9)glucose-1-phosphate thymidylyltransferase (TIGR01208; EC 2.7.7.24; HMM-score: 15.5)hopanoid biosynthesis associated glycosyl transferase protein HpnI (TIGR03472; HMM-score: 14.2)
- TheSEED :
- Beta-1,3-glucosyltransferase
- PFAM: GT-A (CL0110) Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 124.1)and 6 moreGlyco_tranf_2_2; Glycosyltransferase like family 2 (PF10111; HMM-score: 55.2)Glyco_tranf_2_3; Glycosyltransferase like family 2 (PF13641; HMM-score: 48.9)Glyco_tranf_2_4; Glycosyl transferase family 2 (PF13704; HMM-score: 23.4)Glyco_hydro_tim (CL0058) Glyco_hydro_1; Glycosyl hydrolase family 1 (PF00232; HMM-score: 14.8)GT-A (CL0110) Osmo_MPGsynth; Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth) (PF09488; HMM-score: 14.3)DUF273; Protein of unknown function, DUF273 (PF03314; HMM-score: 13.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7258
- Cytoplasmic Membrane Score: 0.1233
- Cell wall & surface Score: 0.0015
- Extracellular Score: 0.1494
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013542
- TAT(Tat/SPI): 0.000116
- LIPO(Sec/SPII): 0.001094
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDDKITVIVPVYNVENYLRKCLDSIISQTYKNIEIVVVNNGSTDASGEICKEFSEMDHRILYIEQENAGISAARNTGLNNMSGNYVTFVDSDDWIELDYVETLYKKITEYQADIAVGNY
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.