Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 15-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae 70585
- locus tag: SP70585_RS14410 [old locus tag: SP70585_1456 ]
- pan locus tag?: PNEUPAN002693000
- symbol: SP70585_RS14410
- pan gene symbol?: cbpM
- synonym:
- product: N-acetylmuramoyl-L-alanine amidase family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP70585_RS14410 [old locus tag: SP70585_1456 ]
- symbol: SP70585_RS14410
- product: N-acetylmuramoyl-L-alanine amidase family protein
- replicon: chromosome
- strand: -
- coordinates: 1349146..1349535
- length: 390
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_012468 (1349146..1349535) NCBI
- BioCyc:
- MicrobesOnline: see SP70585_1456
- PneumoBrowse for strain D39V: SPV_1248 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGTAAAAAGACGTATAAGGAGAGGGACGAGAGAACCTGAAAAAGTTGTTGTTCCTGAG
CAATCATCTATTCCTTCGTATCCTGTATCTGTTACATCTAACCAAGGAACAGATGTAGCA
GTAGAACCAGCTAAAGCAGTTGCTCCAACAACAGGCTGGAAACAAGAAAATGGTATGTGG
TATTTTTATAATACTGATGGTTCCATGGCAACAGGTTGGGTACAAGTTAATGGTTCATGG
TACTACCTCAACAGCAACGGTTCTATGAAAGTTAATCAATGGTTCCAAGTTGGTGGTAAA
TGGTATTATGTAAATGCATCGGGTGAGTTAGCGGTCAATACAAGTATAGATGGCTATAGA
GTCAATGATAATGGTGAATGGGTGCGTTAA60
120
180
240
300
360
390
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP70585_RS14410 [old locus tag: SP70585_1456 ]
- symbol: SP70585_RS14410
- description: N-acetylmuramoyl-L-alanine amidase family protein
- length: 129
- theoretical pI: 9.2589
- theoretical MW: 14536.1
- GRAVY: -0.624031
⊟Function[edit | edit source]
- TIGRFAM: glucan-binding repeat (TIGR04035; HMM-score: 32)
- TheSEED: see SP70585_1456
- PFAM: Choline_binding (CL0694) Choline_bind_3; Choline-binding repeat (PF19127; HMM-score: 75.3)Choline_bind_1; Putative cell wall binding repeat (PF01473; HMM-score: 65.3)and 4 moreCholine_bind_2; Choline-binding repeat (PF19085; HMM-score: 38.4)no clan defined FliC; Flagellin protein (PF12445; HMM-score: 13.2)WW (CL0680) WW; WW domain (PF00397; HMM-score: 12.3)no clan defined WG_beta_rep; WG containing repeat (PF14903; HMM-score: 10)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cell wall & surface
- Cytoplasmic Score: 0.0081
- Cytoplasmic Membrane Score: 0.0054
- Cell wall & surface Score: 0.5215
- Extracellular Score: 0.465
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.08479
- TAT(Tat/SPI): 0.025234
- LIPO(Sec/SPII): 0.007896
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000240827 NCBI
- UniProt: see SP70585_1456
⊟Protein sequence[edit | edit source]
- MVKRRIRRGTREPEKVVVPEQSSIPSYPVSVTSNQGTDVAVEPAKAVAPTTGWKQENGMWYFYNTDGSMATGWVQVNGSWYYLNSNGSMKVNQWFQVGGKWYYVNASGELAVNTSIDGYRVNDNGEWVR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1248 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]