Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-JAN-2018
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae AP200
- locus tag: SPAP_1941 [new locus tag: SPAP_RS09615 ]
- pan locus tag?: PNEUPAN003524000
- symbol: SPAP_1941
- pan gene symbol?: slyA_2
- synonym:
- product: Transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPAP_1941 [new locus tag: SPAP_RS09615 ]
- symbol: SPAP_1941
- product: Transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1813440..1813910
- length: 471
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP002121 (1813440..1813910) NCBI
- BioCyc: see SPAP_RS09615
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2411 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGATAAACCGATGTTAGTCTTTAAGCGTTTTGGTCATCAAATTCACCTGATGGTGCAA
AAGGAAGCCAAACGTTGCGGCATTGAATTTATGGGTGGGCCGCAAGGTCAGGTTGTGCAT
TTTTTGGATAATCGCGAGAAAAACCAAGACTTGGTCTTGATTAAAGATATCGAGCAGGAA
CTCAATATTACCAAGTCTGTTGCTAGTAATCTGGTTAAGCGTATAGTGCAAAATGGTTTG
GTGGAATTGGAGGCGAGTCCTGTTGATAAGCGGGCTAAGTTTGTTCGTCTGACGGACAAA
GCACGTTCTCAGATGCAACAGGTTAAGGCTTTTTTTGAACGCATAGACAAGCAGTTGATG
GAAGACATTGATGAAGATGAATTACTGATTTTTGAGAAAGTTCTCGGTCAACTACAGGCA
AATATCAAGGGAATAGGAGGAGAGAATAAAGAAATTAGTCAAAAGAATTAG60
120
180
240
300
360
420
471
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPAP_1941 [new locus tag: SPAP_RS09615 ]
- symbol: SPAP_1941
- description: Transcriptional regulator
- length: 156
- theoretical pI: 8.50159
- theoretical MW: 17931.7
- GRAVY: -0.465385
⊟Function[edit | edit source]
- TIGRFAM: mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 38.6)and 4 morehomoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 23.6)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 19)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 18.3)DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 17.8)
- TheSEED :
- Transcriptional regulator, MarR family
- PFAM: HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 52.6)and 7 moreHTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 37.7)MarR; MarR family (PF01047; HMM-score: 24.6)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 20.1)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 14.7)no clan defined Tfb5; Transcription factor TFIIH complex subunit Tfb5 (PF06331; HMM-score: 14.4)HTH (CL0123) Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 12.8)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by SlyA_2*, TF important in Multidrug resistance: in TIGR4
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.998
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0
- Extracellular Score: 0.0008
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006166
- TAT(Tat/SPI): 0.000192
- LIPO(Sec/SPII): 0.001104
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ADM85504 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MDKPMLVFKRFGHQIHLMVQKEAKRCGIEFMGGPQGQVVHFLDNREKNQDLVLIKDIEQELNITKSVASNLVKRIVQNGLVELEASPVDKRAKFVRLTDKARSQMQQVKAFFERIDKQLMEDIDEDELLIFEKVLGQLQANIKGIGGENKEISQKN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2411 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]