Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae CGSP14
- locus tag: SPCG_1754 [new locus tag: SPCG_RS09075 ]
- pan locus tag?: PNEUPAN003249000
- symbol: trxA
- pan gene symbol?: trxA
- synonym:
- product: thioredoxin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPCG_1754 [new locus tag: SPCG_RS09075 ]
- symbol: trxA
- product: thioredoxin
- replicon: chromosome
- strand: +
- coordinates: 1740226..1740540
- length: 315
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: CP001033 (1740226..1740540) NCBI
- BioCyc: see SPCG_RS09075
- MicrobesOnline: 5761089 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1567 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAAAAGCAATTACAGATGCAACATTCGAACAAGAAACAAAAGACGGTTTGGTCTTA
GTAGACTTCTGGGCAACTTGGTGTGGTCCATGTCGTATGCAAGGTCCAATCTTGGACAAA
TTGTCTGAAGAACTTTCAGAAGATGTCTTGAAAATCGTTAAAATGGACGTTGATGAAAAT
CCAAATACAGCTCGTGCTTTTGGAATCATGTCTATTCCAACTCTTCTCTTCAAAAAAGAC
GGCCAAGTTGTCAAACAAGTTGCAGGTGTTCACACAGCAGAACAAATCAAGGCCATCATT
GCTGAATTGAGCTAA60
120
180
240
300
315
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPCG_1754 [new locus tag: SPCG_RS09075 ]
- symbol: TrxA
- description: thioredoxin
- length: 104
- theoretical pI: 4.49791
- theoretical MW: 11449.2
- GRAVY: 0.0317308
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 116.2)and 8 moreProtein fate Protein folding and stabilization protein disulfide-isomerase domain (TIGR01126; HMM-score: 60.4)protein disulfide isomerase (TIGR01130; HMM-score: 51.5)Protein fate Protein folding and stabilization periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily (TIGR00385; HMM-score: 37.9)Unknown function General redox-active disulfide protein 1 (TIGR00411; HMM-score: 27.5)glutaredoxin-like domain protein (TIGR02187; HMM-score: 21.4)glutaredoxin-like protein (TIGR02200; HMM-score: 15.2)Central intermediary metabolism Sulfur metabolism 5'-adenylylsulfate reductase, thioredoxin-independent (TIGR00424; HMM-score: 12.4)CRISPR-associated protein Cas8a1/Csx13, MYXAN subtype, C-terminal region (TIGR03486; HMM-score: 12)
- TheSEED :
- Thioredoxin
- PFAM: Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 98)and 12 moreThioredoxin_8; Thioredoxin-like (PF13905; HMM-score: 28.8)Redoxin; Redoxin (PF08534; HMM-score: 28.5)Thioredoxin_2; Thioredoxin-like domain (PF13098; HMM-score: 27.5)Thioredoxin_9; Thioredoxin (PF14595; HMM-score: 23.6)AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 21.9)KaiB; KaiB domain (PF07689; HMM-score: 21.5)TraF; F plasmid transfer operon protein (PF13728; HMM-score: 20)HyaE; Hydrogenase-1 expression protein HyaE (PF07449; HMM-score: 17.1)Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 16)Thioredoxin_7; Thioredoxin-like (PF13899; HMM-score: 13.4)Glrx-like; Glutaredoxin-like domain (DUF836) (PF05768; HMM-score: 12.9)OST3_OST6; OST3 / OST6 family, transporter family (PF04756; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9099
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0894
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006667
- TAT(Tat/SPI): 0.000729
- LIPO(Sec/SPII): 0.00165
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACB91006 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MAKAITDATFEQETKDGLVLVDFWATWCGPCRMQGPILDKLSEELSEDVLKIVKMDVDENPNTARAFGIMSIPTLLFKKDGQVVKQVAGVHTAEQIKAIIAELS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1567 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]