Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 16-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae CGSP14
- locus tag: SPCG_RS00425 [old locus tag: SPCG_0077 ]
- pan locus tag?: PNEUPAN000707000
- symbol: SPCG_RS00425
- pan gene symbol?: epsH
- synonym:
- product: glycosyltransferase family 2 protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPCG_RS00425 [old locus tag: SPCG_0077 ]
- symbol: SPCG_RS00425
- product: glycosyltransferase family 2 protein
- replicon: chromosome
- strand: +
- coordinates: 79513..80052
- length: 540
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAAGTTATTGTCTATCGCAATTTCTAGCTATAATGCAGCAGCCTATCTTCATTACTGT
GTGGAGTCGCTAGTGATTGGTGGTGAGCAAGTTGGGATTTTGATTATCAATGACGGGTCT
CAGGATCAGACTCAGGAAATCGCTGAGTGTTTAGCTAGCAAGTATCCTAATATCGTTAGA
GCCATCTATCAGGAAAATAAATGCCATGGCGGTGCGGTCAATCGTGGCTTGGCAGAGGCT
TCTGGGCGCTATTTTAAAGTAGTTGACAGTGATGACTGGGTGGATCCTCGTGCCTACTTG
AAAATTCTTGAAACCTTGCAGGAACTTGAGAGCAAAGGTCAAGAGGTGGATGTCTTTGTG
ACCAATTTTGTCTATGAAAAGGAAGGGCAGTCTCGTAAGAAGAGTATGAGTTACGATTCA
GTCTTGCCTGTTCGGCAGATTTTTGGCTGGGACCAGGTCGGAAATTTCTCCAAAGGCCAG
TATACCATGATGCACTCGCTGATTTATCGGACAGATTTGTTGCGTGCTAGCCAGTTCTAA60
120
180
240
300
360
420
480
540
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPCG_RS00425 [old locus tag: SPCG_0077 ]
- symbol: SPCG_RS00425
- description: glycosyltransferase family 2 protein
- length: 179
- theoretical pI: 5.27703
- theoretical MW: 20208.8
- GRAVY: -0.240223
⊟Function[edit | edit source]
- reaction: EC 2.4.-.-? ExPASy
- TIGRFAM: poly-beta-1,6 N-acetyl-D-glucosamine synthase (TIGR03937; EC 2.4.1.-; HMM-score: 46.4)and 6 moreputative glycosyltransferase, exosortase G-associated (TIGR03111; HMM-score: 31.1)Unknown function Enzymes of unknown specificity transferase 2, rSAM/selenodomain-associated (TIGR04283; EC 2.-.-.-; HMM-score: 28.1)mycofactocin system glycosyltransferase (TIGR03965; HMM-score: 22.2)glycosyltransferase, TIGR04182 family (TIGR04182; HMM-score: 20.4)colanic acid biosynthesis glycosyltransferase WcaE (TIGR04009; EC 2.4.-.-; HMM-score: 16.7)hopene-associated glycosyltransferase HpnB (TIGR03469; HMM-score: 12.5)
- TheSEED: see SPCG_0077
- PFAM: GT-A (CL0110) Glycos_transf_2; Glycosyl transferase family 2 (PF00535; HMM-score: 77.2)and 4 moreGlyco_tranf_2_3; Glycosyltransferase like family 2 (PF13641; HMM-score: 35.5)Glyco_tranf_2_2; Glycosyltransferase like family 2 (PF10111; HMM-score: 22.2)Glyco_tranf_2_4; Glycosyl transferase family 2 (PF13704; HMM-score: 13.1)no clan defined BSD; BSD domain (PF03909; HMM-score: 12.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7075
- Cytoplasmic Membrane Score: 0.214
- Cell wall & surface Score: 0.0032
- Extracellular Score: 0.0752
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.183751
- TAT(Tat/SPI): 0.00088
- LIPO(Sec/SPII): 0.016459
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000771898 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKLLSIAISSYNAAAYLHYCVESLVIGGEQVGILIINDGSQDQTQEIAECLASKYPNIVRAIYQENKCHGGAVNRGLAEASGRYFKVVDSDDWVDPRAYLKILETLQELESKGQEVDVFVTNFVYEKEGQSRKKSMSYDSVLPVRQIFGWDQVGNFSKGQYTMMHSLIYRTDLLRASQF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]