Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-MAY-2018
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae D39
- locus tag: SPD_0133 [new locus tag: SPD_RS00740 ]
- pan locus tag?: PNEUPAN000825000
- symbol: SPD_0133
- pan gene symbol?: cibA
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPD_0133 [new locus tag: SPD_RS00740 ]
- symbol: SPD_0133
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 137522..137707
- length: 186
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000410 (137522..137707) NCBI
- BioCyc: see SPD_RS00740
- MicrobesOnline: 2017082 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0133 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACAAATTTTGACATTCTTGACAATCAATTTTTATCCTTATCTGAAAATGAATTGTCA
GATATTGATGGCGGTCTCGCTCCCTTGGTTATCTTTGGAGTAGCAGTATCTTGGAAGGCT
ATTGCAGGTGGAACAGCACTTATAGGTTCTGGTTTGGCAGCTGGTTATTTTTTAGGAGGA
GATTAA60
120
180
186
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPD_0133 [new locus tag: SPD_RS00740 ]
- symbol: SPD_0133
- description: hypothetical protein
- length: 61
- theoretical pI: 3.42376
- theoretical MW: 6203.96
- GRAVY: 0.645902
⊟Function[edit | edit source]
- TIGRFAM: class IIb bacteriocin, lactobin A/cerein 7B family (TIGR03949; HMM-score: 33.6)
- TheSEED :
- Two-peptide bacteriocin peptide CibA
- PFAM: GG-leader (CL0400) Bacteriocin_IIc; Bacteriocin class II with double-glycine leader peptide (PF10439; HMM-score: 20.9)and 1 moreLactococcin; Lactococcin-like family (PF04369; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.029139
- TAT(Tat/SPI): 0.003436
- LIPO(Sec/SPII): 0.002395
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGTALIGSGLAAGYFLGGD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0133 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Jelle Slager, Rieza Aprianto, Jan-Willem Veening
Refining the Pneumococcal Competence Regulon by RNA Sequencing.
J Bacteriol: 2019, 201(13);
[PubMed:30885934] [WorldCat.org] [DOI] (I e)