Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_0112 [new locus tag: SPG_RS00570 ]
- pan locus tag?: PNEUPAN000769000
- symbol: SPG_0112
- pan gene symbol?: rtgL
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_0112 [new locus tag: SPG_RS00570 ]
- symbol: SPG_0112
- product: conserved hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 114893..115105
- length: 213
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (114893..115105) NCBI
- BioCyc: see SPG_RS00570
- MicrobesOnline: 5755381 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_2100 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGTTGATTGTTTTAATTTCAGTTATTGTTGCATTCCTGTATCATAAAATTACAGAGTAT
GTCAACAACAGGAAAATTGATATTGTTATTTTTCTATCATTGCTGATTTCTCATTTTATT
TGGAATTACTATTTTTTACCAATTGAAATATTGATAGCAATCAGTGGAGCAAATTTACTA
TTAAGTTTTTTAAAAAAATTACAGATTAAATAA60
120
180
213
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_0112 [new locus tag: SPG_RS00570 ]
- symbol: SPG_0112
- description: conserved hypothetical protein
- length: 70
- theoretical pI: 9.88226
- theoretical MW: 8208.01
- GRAVY: 1.19286
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined EII-Sor; PTS system sorbose-specific iic component (PF03609; HMM-score: 14.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.9586
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0409
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001051
- TAT(Tat/SPI): 0.000068
- LIPO(Sec/SPII): 0.002741
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF54762 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLIVLISVIVAFLYHKITEYVNNRKIDIVIFLSLLISHFIWNYYFLPIEILIAISGANLLLSFLKKLQIK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2100 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]