Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_0554 [new locus tag: SPG_RS02800 ]
- pan locus tag?: PNEUPAN001505000
- symbol: SPG_0554
- pan gene symbol?: glnQ2
- synonym:
- product: ABC transporter, ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_0554 [new locus tag: SPG_RS02800 ]
- symbol: SPG_0554
- product: ABC transporter, ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 537994..538752
- length: 759
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (537994..538752) NCBI
- BioCyc: see SPG_RS02800
- MicrobesOnline: 5755823 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_0531 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGGCTTTAGTAGAATTTAAAAACGTCGAAAAATATTACGGAGACTACCATGCACTCCGC
GACATCAATCTCCGTTTTGAAAAAGGACAAGTCGTTGTCCTACTCGGACCATCTGGTTCT
GGGAAATCCACTCTTATCCGTACCATCAATGGTTTGGAGGCTGTCGACAAGGGAAGCCTT
CTAGTCAATGGCCACCAAGTTGCTGGTGCCAGCCAGAAAGATTTGGTACCTCTTCGCAAG
GAAGTCGGCATGGTTTTCCAGCATTTTAACCTCTACCCTCACAAAACAGTGTTAGAAAAC
GTAACACTCGCACCCATTAAANTTCTAGGAATTGATAAAAAAGAAGCTGAAAAAACCGCC
CAAAAATATCTGGAATTTGTAAATATGTGGGACAAGAAAGATTCCTATCCCGCCATGCTA
TCTGGTGGACAAAAACAGCGGATCGCCATCGCTCGTGGTCTTGCTATGCATCCGGAACTC
CTCCTCTTTGATGAACCAACATCTGCTCTTGATCCTGAGACTATCGGAGATGTTCTAGCA
GTTATGCAGAAACTGGCGCATGATGGGATGAACATGATCATCGTTACCCACGAAATGGGC
TTTGCTCGAGAGGTTGCGGACCGCATTATCTTTATGGCCGACGGAGAAGTTTTAGTAGAT
ACGACAGATGTCGATAACTTTTTTGACAATCCAAGCGAACCTCGTGCCCAACAATTCCTC
AGCAAAATTATCAACCACGAAAGTGACAAAGTCAAATAA60
120
180
240
300
360
420
480
540
600
660
720
759
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_0554 [new locus tag: SPG_RS02800 ]
- symbol: SPG_0554
- description: ABC transporter, ATP-binding protein
- length: 252
- theoretical pI: 6.10049
- theoretical MW: 28008.1
- GRAVY: -0.19761
⊟Function[edit | edit source]
- TIGRFAM: ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 280.6)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 235.8)and 79 moreD-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 201.7)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 199.1)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 197.9)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 197.3)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 196.7)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 190.6)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 189.5)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 184.4)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 175.8)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 168.7)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 168.7)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 162.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 160.4)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 159.9)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 157.9)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 150.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 146.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 145.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 140.4)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 138.6)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 138.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 137.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 134.4)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 130.4)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 130.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 125.6)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 125.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 124.7)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 124.7)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 124.5)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 123.9)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 123.9)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 122.7)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 118.9)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 118)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 117.9)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 117.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 115.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 114.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 114.1)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 113.4)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 112)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 112)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 111.5)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.6)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 109.6)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 109.2)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 105.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 102.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 101.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 92.9)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 91.5)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 86.1)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 85.9)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 85.6)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 85.6)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 85.6)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 84.2)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 76.4)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 71.8)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 66.1)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 66.1)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 56.3)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 50.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 47.8)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 47.4)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 37.9)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 15.2)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 14.4)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions guanylate kinase (TIGR03263; EC 2.7.4.8; HMM-score: 13.4)Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 12.6)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 12.5)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 12)Central intermediary metabolism Sulfur metabolism adenylyl-sulfate kinase (TIGR00455; EC 2.7.1.25; HMM-score: 12)rad50 (TIGR00606; HMM-score: 10.2)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 9.3)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 9.3)
- TheSEED :
- Glutamate transporter, involved in acid tolerance, ATP-binding protein
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 123.1)and 32 moreSMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 37)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 33.4)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 22.7)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 22.7)AAA_13; AAA domain (PF13166; HMM-score: 22.3)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 21.7)AAA_23; AAA domain (PF13476; HMM-score: 21.3)AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.5)AAA_30; AAA domain (PF13604; HMM-score: 18.9)AAA_22; AAA domain (PF13401; HMM-score: 16.8)AAA_10; AAA-like domain (PF12846; HMM-score: 16.2)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 16.1)AAA_18; AAA domain (PF13238; HMM-score: 15.6)AAA_33; AAA domain (PF13671; HMM-score: 15.6)DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 15)AAA_24; AAA domain (PF13479; HMM-score: 14.5)NACHT; NACHT domain (PF05729; HMM-score: 14)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 13.8)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 13.7)IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 13.4)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.3)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 13.3)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.2)AAA_PrkA; PrkA AAA domain (PF08298; HMM-score: 13.2)Rad17; Rad17 P-loop domain (PF03215; HMM-score: 12.8)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.6)G-alpha; G-protein alpha subunit (PF00503; HMM-score: 12.3)DUF815; Protein of unknown function (DUF815) (PF05673; HMM-score: 11.8)AAA_28; AAA domain (PF13521; HMM-score: 11.8)SH3 (CL0010) SH3_2; Variant SH3 domain (PF07653; HMM-score: 11.6)P-loop_NTPase (CL0023) NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.3)Adeno_IVa2; Adenovirus IVa2 protein (PF02456; HMM-score: 10.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.1049
- Cytoplasmic Membrane Score: 0.8258
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0692
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007948
- TAT(Tat/SPI): 0.000722
- LIPO(Sec/SPII): 0.000474
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF56261 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MALVEFKNVEKYYGDYHALRDINLRFEKGQVVVLLGPSGSGKSTLIRTINGLEAVDKGSLLVNGHQVAGASQKDLVPLRKEVGMVFQHFNLYPHKTVLENVTLAPIKXLGIDKKEAEKTAQKYLEFVNMWDKKDSYPAMLSGGQKQRIAIARGLAMHPELLLFDEPTSALDPETIGDVLAVMQKLAHDGMNMIIVTHEMGFAREVADRIIFMADGEVLVDTTDVDNFFDNPSEPRAQQFLSKIINHESDKVK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: GlnR (repression) regulon
GlnR (TF) important in Nitrogen assimilation; RegPrecise
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0531 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.