Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_0984
- pan locus tag?:
- symbol: SPG_0984
- pan gene symbol?: —
- synonym:
- product: ABC transporter, permease protein, point mutation
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_0984
- symbol: SPG_0984
- product: ABC transporter, permease protein, point mutation
- replicon: chromosome
- strand: +
- coordinates: 944856..945263
- length: 408
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (944856..945263) NCBI
- BioCyc:
- MicrobesOnline: 5756253 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTAGAGAAGAACATCACAATATTCTATCCATTGTAGCTAGTAGGATGATATCTCGA
ATCGGAGATATCATGTTTGATTTCGCCAATAATACCTTTCTTGCTGGTCTTAATCCAACA
TCTCTATCAGTGGTTGCAATTTATCAATCATTAGAAAGTATGATAGGTGTTCTATTTAAT
TTATTTGGTGGAGTTATTGCAGATAGTTTCAAGCGGAAAAAAATTATTATTACTACAAAT
ATCTTATGTGGTATTGCTTGCATAACTCTTTCATTTATATCCCAAGAAAAATGGTTGGTT
TATGCGATAGTCATAACAAATGTCATTTTGGCTTTTATGAGTGCTTTTTCAGGGCCATCA
TACAAAGCTTTTACGAAAGAAATTGTAAAAAAGGACAGTATATCATAA60
120
180
240
300
360
408
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_0984
- symbol: SPG_0984
- description: ABC transporter, permease protein, point mutation
- length: 135
- theoretical pI: 9.20182
- theoretical MW: 14944.6
- GRAVY: 0.654074
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds H+ Antiporter protein (TIGR00900; HMM-score: 50.1)and 3 moreTransport and binding proteins Anions nitrite transporter (TIGR00886; HMM-score: 27.6)multidrug resistance protein (TIGR00880; HMM-score: 18)Transport and binding proteins Unknown substrate MFS transporter, metabolite:H+ symporter (MHS) family protein (TIGR00883; HMM-score: 17.2)
- TheSEED:
- PFAM: MFS (CL0015) MFS_3; Transmembrane secretion effector (PF05977; HMM-score: 42.8)and 7 moreFPN1; Ferroportin1 (FPN1) (PF06963; HMM-score: 32.5)MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 28.3)ATG22; Vacuole effluxer Atg22 like (PF11700; HMM-score: 17.4)Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 17.2)no clan defined Wzz; Chain length determinant protein (PF02706; HMM-score: 17.2)MFS (CL0015) MFS_5; Sugar-tranasporters, 12 TM (PF05631; HMM-score: 16.2)no clan defined DUF6722; Family of unknown function (DUF6722) (PF20482; HMM-score: 9.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9997
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003796
- TAT(Tat/SPI): 0.000505
- LIPO(Sec/SPII): 0.000868
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF54766 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIREEHHNILSIVASRMISRIGDIMFDFANNTFLAGLNPTSLSVVAIYQSLESMIGVLFNLFGGVIADSFKRKKIIITTNILCGIACITLSFISQEKWLVYAIVITNVILAFMSAFSGPSYKAFTKEIVKKDSIS
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]