Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_1832
- pan locus tag?:
- symbol: SPG_1832
- pan gene symbol?: —
- synonym:
- product: ABC transporter, permease protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_1832
- symbol: SPG_1832
- product: ABC transporter, permease protein
- replicon: chromosome
- strand: -
- coordinates: 1747184..1747612
- length: 429
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (1747184..1747612) NCBI
- BioCyc:
- MicrobesOnline: 5757099 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATTTTACTAGCCATTCTCTTTACTTGCTTTTCGGTCTATCTAGAGTTGGAAGTGCCG
ACCTATATCTCGAAAATTACGGATTTGCTAGGTAGTCAAGAAACTAATTTAGATGAGTTG
TGGCAGCCGGCAAGCATGATGATGGGAATGCTCTTTCTTGCCTTCTTGTCCGTAGTTGCA
GTTGGATTTTTTGCATCCCGAGTGGCGGCTTCTTATACTAGTAGGCTGAGAAGTGATATT
TTTAACCGAGTTTTGGATTACTCGCAGACAGAGATTAAGAAATTTTCAATTCCTAGCCTC
TTGACGCGTACTACCAATGACATTACTCAAGTTCAAATGTTGATTACTATGGGCTTGCAA
GTGGTAACGCGTGGTCCAATTATGGCTATCTGGGCTATTGGGAAGATTTTAGGTCATTCA
GAATACTGA60
120
180
240
300
360
420
429
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_1832
- symbol: SPG_1832
- description: ABC transporter, permease protein
- length: 142
- theoretical pI: 5.82095
- theoretical MW: 15969.8
- GRAVY: 0.541549
⊟Function[edit | edit source]
- TIGRFAM: ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 29.6)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 28.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 27.4)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 27.4)and 6 moreTransport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 18.1)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 18.1)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 16.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides putative PLP-dependent aminotransferase (TIGR04422; HMM-score: 14.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 13.8)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 13.8)
- TheSEED :
- Multidrug resistance ABC transporter ATP-binding and permease protein
- PFAM: ABC_membrane (CL0241) ABC_membrane; ABC transporter transmembrane region (PF00664; HMM-score: 35.8)and 1 moreTrkA_C (CL0582) Castor_Poll_mid; Castor and Pollux, part of voltage-gated ion channel (PF06241; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.016057
- TAT(Tat/SPI): 0.000186
- LIPO(Sec/SPII): 0.019272
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF55010 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MILLAILFTCFSVYLELEVPTYISKITDLLGSQETNLDELWQPASMMMGMLFLAFLSVVAVGFFASRVAASYTSRLRSDIFNRVLDYSQTEIKKFSIPSLLTRTTNDITQVQMLITMGLQVVTRGPIMAIWAIGKILGHSEY
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.