Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_1947
- pan locus tag?:
- symbol: SPG_1947
- pan gene symbol?: —
- synonym:
- product: L-ribulose-5-phosphate 4-epimerase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_1947
- symbol: SPG_1947
- product: L-ribulose-5-phosphate 4-epimerase
- replicon: chromosome
- strand: -
- coordinates: 1850562..1850822
- length: 261
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (1850562..1850822) NCBI
- BioCyc:
- MicrobesOnline: 5757214 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATCAAGTAATCAATGCTATGCGTAAACGAGTCTGTGATGCCAATCAATCATTGCCA
AAACATGGACTTGTCAAATTTACCTGGGGGAATGTATCTGAAGTCAATCGCGAACTCGGT
GTCATTGTTATCAAACCATCAGGCGTGGATTATGACGAATTGACACCTGAAAACATGGTA
GTGACTGATCTAGATGGTAAGATCCTAGAAAGGGGATTTAAGACCATCTTCCGACCTCCC
AACTCATGTGCAATTATATAA60
120
180
240
261
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_1947
- symbol: SPG_1947
- description: L-ribulose-5-phosphate 4-epimerase
- length: 86
- theoretical pI: 8.22472
- theoretical MW: 9628.13
- GRAVY: -0.155814
⊟Function[edit | edit source]
- reaction: EC 5.1.3.4? ExPASyL-ribulose-5-phosphate 4-epimerase L-ribulose 5-phosphate = D-xylulose 5-phosphate
- TIGRFAM: Energy metabolism Sugars L-ribulose-5-phosphate 4-epimerase (TIGR00760; EC 5.1.3.4; HMM-score: 82.1)and 3 moreEnergy metabolism Sugars L-fuculose phosphate aldolase (TIGR01086; EC 4.1.2.17; HMM-score: 24.7)Amino acid biosynthesis Aspartate family methylthioribulose-1-phosphate dehydratase (TIGR03328; EC 4.2.-.-; HMM-score: 24.2)Hypothetical proteins Conserved tRNA pseudouridine(54/55) synthase (TIGR01213; EC 5.4.99.25; HMM-score: 10.9)
- TheSEED :
- L-ribulose-5-phosphate 4-epimerase (EC 5.1.3.4)
- PFAM: no clan defined Aldolase_II; Class II Aldolase and Adducin N-terminal domain (PF00596; HMM-score: 51.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.89
- Cytoplasmic Membrane Score: 0.0045
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1055
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005232
- TAT(Tat/SPI): 0.000292
- LIPO(Sec/SPII): 0.000953
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF56682 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNQVINAMRKRVCDANQSLPKHGLVKFTWGNVSEVNRELGVIVIKPSGVDYDELTPENMVVTDLDGKILERGFKTIFRPPNSCAII
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: tktA < SPG_1944 < SPG_1945 < SPG_1946 < SPG_1947 < SPG_1948 < SPG_1949 < SPG_1950 < SPG_1951 < SPG_1952
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]