Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 30-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae G54
- locus tag: SPG_1960
- pan locus tag?:
- symbol: SPG_1960
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPG_1960
- symbol: SPG_1960
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1860078..1860458
- length: 381
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP001015 (1860078..1860458) NCBI
- BioCyc:
- MicrobesOnline: 5757227 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTTGGAGCAAGCTCGTTTGAAAGTGGAGCAGCAAGCAATCAAGAATATCCAGTTTTTG
GAGCAAGATTTACCGAAAAATCCCTTGGAGAAAGAGTTTGATTGCCTTGCTGTTAGTCGG
GTTCTTCATCATATGCCTGATTTGGATGCGGCTCTCTCACTGTTTCATCAACATTTGAAG
GAAGATGGGAAACTCATCATTGCTGATTTTACCAAGACAGAAGCTAATCATCATGGATTT
GATTTAGCTGAACTGGAAAACAAGCTAATTGAGCATGGTTTTTCATCTGTGCATAGTCAG
ATTCTCTATAGCGCTNAAGACCTGTTTCAAGGAAATCACTCAGAATTCTTTTTAATAGTA
GCCCAAAAATCACTCGCCTAG60
120
180
240
300
360
381
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPG_1960
- symbol: SPG_1960
- description: hypothetical protein
- length: 126
- theoretical pI: 5.74919
- theoretical MW: 14274.2
- GRAVY: -0.2232
⊟Function[edit | edit source]
- TIGRFAM: Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone ubiquinone/menaquinone biosynthesis methyltransferase (TIGR01934; EC 2.1.1.-; HMM-score: 27.8)Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 27.5)Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 24.5)and 2 moreBiosynthesis of cofactors, prosthetic groups, and carriers Glutathione and analogs putative 4-mercaptohistidine N1-methyltranferase (TIGR04345; HMM-score: 12.8)Transport and binding proteins Cations and iron carrying compounds (2,3-dihydroxybenzoyl)adenylate synthase (TIGR02275; EC 2.7.7.58; HMM-score: 11.5)
- TheSEED :
- Methylase involved in ubiquinone/menaquinone biosynthesis
- PFAM: NADP_Rossmann (CL0063) Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 35.8)Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 34.1)Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 31.9)Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 31.4)Methyltransf_23; Methyltransferase domain (PF13489; HMM-score: 29.6)and 6 moreUbie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 27.9)NodS; Nodulation protein S (NodS) (PF05401; HMM-score: 16.8)CheR; CheR methyltransferase, SAM binding domain (PF01739; HMM-score: 15.9)Bmt2; 25S rRNA (adenine(2142)-N(1))-methyltransferase, Bmt2 (PF11968; HMM-score: 13.9)PDDEXK (CL0236) RE_TaqI; TaqI restriction endonuclease (PF09573; HMM-score: 13.5)NADP_Rossmann (CL0063) NNMT_PNMT_TEMT; NNMT/PNMT/TEMT family (PF01234; HMM-score: 11.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.929
- Cytoplasmic Membrane Score: 0.0432
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0269
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.000726
- TAT(Tat/SPI): 0.000075
- LIPO(Sec/SPII): 0.000103
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ACF56765 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLEQARLKVEQQAIKNIQFLEQDLPKNPLEKEFDCLAVSRVLHHMPDLDAALSLFHQHLKEDGKLIIADFTKTEANHHGFDLAELENKLIEHGFSSVHSQILYSAXDLFQGNHSEFFLIVAQKSLA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SPG_1953 < SPG_1954 < SPG_1955 < rnpA < SPG_1957 < ackA < SPG_1959 < SPG_1960 < SPG_1961
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]