Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_0304 [new locus tag: SPH_RS01460 ]
- pan locus tag?: PNEUPAN000916000
- symbol: SPH_0304
- pan gene symbol?: —
- synonym:
- product: phage protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_0304 [new locus tag: SPH_RS01460 ]
- symbol: SPH_0304
- product: phage protein
- replicon: chromosome
- strand: +
- coordinates: 266055..266474
- length: 420
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000936 (266055..266474) NCBI
- BioCyc: see SPH_RS01460
- MicrobesOnline: 5695157 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACACCAGAGCAAGTAAAAGAAAAACTAGAGGGCGTTAAGTGGATAAACAAGGAGATC
AAAGGCTTATATTTGGAATTGGAAACCCTGGAAGGTGGCATTATCAAAAAACCAACACTA
AGCCATAGCAGGGTGCAGACAAGTAGAGAGAATAAGACAGAGAACAATCTTATAAGTGTT
CTGAAGCTAAAAGAGGACACTTTACAGAGAATTGAGCGACTTACTGAAGAGAGAATGAAA
ATATCTGAGCTAATCGATAAACTGGCCAATCCGCTTGAGCGTTCTGTTCTAAGACTTTTT
TACTTGAATGATCTTGTAGTTTCGGAGGTGGCTGAAGAAATAGATAGATCAAATACTACA
GTATACATTATAAGGCAAAAAGCTATAGAACACTTAACAGGTATTGTAAACGGGGATTGA60
120
180
240
300
360
420
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_0304 [new locus tag: SPH_RS01460 ]
- symbol: SPH_0304
- description: phage protein
- length: 139
- theoretical pI: 5.86592
- theoretical MW: 16070.4
- GRAVY: -0.46259
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 37.1)and 12 moreRNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 24.7)RNA polymerase sigma-70 factor, TIGR02954 family (TIGR02954; HMM-score: 24.3)RNA polymerase sigma-70 factor, Bacteroides expansion family 1 (TIGR02985; HMM-score: 24)RNA polymerase sigma-70 factor, sigma-E family (TIGR02983; HMM-score: 23)RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 22.7)RNA polymerase sigma factor, FliA/WhiG family (TIGR02479; HMM-score: 22.6)RNA polymerase sigma-70 factor, TIGR02952 family (TIGR02952; HMM-score: 19.1)RNA polymerase sigma-B factor (TIGR02941; HMM-score: 16.6)RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family (TIGR02989; HMM-score: 15.6)Cellular processes Sporulation and germination RNA polymerase sigma-F factor (TIGR02885; HMM-score: 15.1)Transcription Transcription factors RNA polymerase sigma-F factor (TIGR02885; HMM-score: 15.1)RNA polymerase sigma-70 factor, Myxococcales family 1 (TIGR03001; HMM-score: 12.1)
- TheSEED :
- Phage protein
- PFAM: HTH (CL0123) DUF1492; Protein of unknown function (DUF1492) (PF07374; HMM-score: 42.5)and 7 moreSigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 22.5)Sigma70_r4_2; Sigma-70, region 4 (PF08281; HMM-score: 22.2)UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 18.8)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 16.8)PKinase (CL0016) CotH; CotH kinase protein (PF08757; HMM-score: 15.9)HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 13.1)no clan defined Het-C; Heterokaryon incompatibility protein Het-C (PF07217; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7059
- Cytoplasmic Membrane Score: 0.1316
- Cell wall & surface Score: 0.0155
- Extracellular Score: 0.147
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002388
- TAT(Tat/SPI): 0.000362
- LIPO(Sec/SPII): 0.000434
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTPEQVKEKLEGVKWINKEIKGLYLELETLEGGIIKKPTLSHSRVQTSRENKTENNLISVLKLKEDTLQRIERLTEERMKISELIDKLANPLERSVLRLFYLNDLVVSEVAEEIDRSNTTVYIIRQKAIEHLTGIVNGD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]