Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_0735 [new locus tag: SPH_RS03575 ]
- pan locus tag?: PNEUPAN001542000
- symbol: SPH_0735
- pan gene symbol?: —
- synonym:
- product: transposase family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_0735 [new locus tag: SPH_RS03575 ]
- symbol: SPH_0735
- product: transposase family protein
- replicon: chromosome
- strand: -
- coordinates: 685580..685825
- length: 246
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000936 (685580..685825) NCBI
- BioCyc: see SPH_RS03575
- MicrobesOnline: 5695578 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGACAATGCTATATGGCATAAATCAAGTACCTTAAAGATTCCGACTAATATTGGCTTT
GCATTTATTCCTCCATACACACCAGAGATGAACCCCATTGAACAAGTGTGGAAAGAGATT
CGTAAACGTGGATTTAAGAATAAAGCCTTTCGAACTTTGGAAGATGTCATACAAGGACTG
GAGAAGGAGGTGATAAAGTCCATCGTTAATCGGAGATGGACTAGAATGCTTTTTGAAAGC
AGATGA60
120
180
240
246
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_0735 [new locus tag: SPH_RS03575 ]
- symbol: SPH_0735
- description: transposase family protein
- length: 81
- theoretical pI: 10.8068
- theoretical MW: 9677.25
- GRAVY: -0.545679
⊟Function[edit | edit source]
- TIGRFAM: B12-binding domain/radical SAM domain protein, Ta0216 family (TIGR04190; HMM-score: 10.7)
- TheSEED :
- Mobile element protein
- PFAM: RNase_H (CL0219) DDE_3; DDE superfamily endonuclease (PF13358; HMM-score: 39.1)and 4 moreno clan defined Antimicrobial19; Pseudin antimicrobial peptide (PF08225; HMM-score: 14.4)RNase_H (CL0219) DDE_Tnp_ISAZ013; Rhodopirellula transposase DDE domain (PF07592; HMM-score: 13.1)rve_3; Integrase core domain (PF13683; HMM-score: 12.2)no clan defined HTH_62; Recombinase-like helix-turn-helix domain (PF20552; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5301
- Cytoplasmic Membrane Score: 0.0154
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.4541
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.022441
- TAT(Tat/SPI): 0.000235
- LIPO(Sec/SPII): 0.001017
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDNAIWHKSSTLKIPTNIGFAFIPPYTPEMNPIEQVWKEIRKRGFKNKAFRTLEDVIQGLEKEVIKSIVNRRWTRMLFESR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]