Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_1108
- pan locus tag?:
- symbol: SPH_1108
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_1108
- symbol: SPH_1108
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1023175..1023432
- length: 258
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000936 (1023175..1023432) NCBI
- BioCyc:
- MicrobesOnline: 5695945 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241TTGAGCAAGGCAAATCAACTCTTGGAACAAATCCATGAAGAAGGAATCAGACAATCCTTG
GCAGAAGAAGTAGAAAATCTAAAAGCTGCCACAAACAAGGTTGATGCAGACTTGGATGAA
GTAAACAGTCAGGTAAAAGATGTTTTGACTCGTATCGCTAGCGCCCTTCAACAAGAAAAG
GAAAATGCTGAGCAAGATTCTCAGACACTTGTACTCTATCAAAAACTCTACGATATTCTC
ATGTCGCTTAGAAAGTAA60
120
180
240
258
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_1108
- symbol: SPH_1108
- description: hypothetical protein
- length: 85
- theoretical pI: 4.38856
- theoretical MW: 9671.8
- GRAVY: -0.610588
⊟Function[edit | edit source]
- TIGRFAM: two transmembrane protein (TIGR04527; HMM-score: 13.1)Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 11.1)SH3 domain protein (TIGR04211; HMM-score: 10.9)
- TheSEED :
- hypothetical protein
- PFAM: tRNA_bind_arm (CL0298) Seryl_tRNA_N; Seryl-tRNA synthetase N-terminal domain (PF02403; HMM-score: 17.8)no clan defined Pex19; Pex19 protein family (PF04614; HMM-score: 16.4)DUF6664; Family of unknown function (DUF6664) (PF20369; HMM-score: 15.8)Laminin_II; Laminin Domain II (PF06009; HMM-score: 15.7)Tmemb_cc2; Predicted transmembrane and coiled-coil 2 protein (PF10267; HMM-score: 14.5)and 9 moreATG17_like; Autophagy protein ATG17-like domain (PF04108; HMM-score: 13.5)CCDC22; Coiled-coil domain-containing protein 22 (PF05667; HMM-score: 13.2)FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 12.9)Traffic (CL0147) Sec20; Sec20 (PF03908; HMM-score: 12.4)no clan defined Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 12.4)P-loop_NTPase (CL0023) GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 11.9)no clan defined Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 11.8)Prominin; Prominin (PF05478; HMM-score: 11)Zn_Beta_Ribbon (CL0167) DUF1451; Zinc-ribbon containing domain (PF07295; HMM-score: 10.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.4886
- Cytoplasmic Membrane Score: 0.2561
- Cell wall & surface Score: 0.0013
- Extracellular Score: 0.254
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005874
- TAT(Tat/SPI): 0.001753
- LIPO(Sec/SPII): 0.000911
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKANQLLEQIHEEGIRQSLAEEVENLKAATNKVDADLDEVNSQVKDVLTRIASALQQEKENAEQDSQTLVLYQKLYDILMSLRK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]