Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hungary19A-6
- locus tag: SPH_RS14335
- pan locus tag?: PNEUPAN002603000
- symbol: SPH_RS14335
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPH_RS14335
- symbol: SPH_RS14335
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1338662..1338826
- length: 165
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_010380 (1338662..1338826) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATACCATCAGGATTATATAAGATTGATACAGGAAAAGTTTTATTTGATGGTGTAAATATT
AATCAAATAGATAAAAAAATATTAAGTCAAAATTTAGGAGTAGTTCCACAGGATTCATTT
TTATTGAACCGAAGTATTCTTGATAACATAACTTTAAAGCACTAG60
120
165
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPH_RS14335
- symbol: SPH_RS14335
- description: hypothetical protein
- length: 54
- theoretical pI: 9.16314
- theoretical MW: 6024.97
- GRAVY: -0.0314815
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 43.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 43.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 39.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 35.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 35.3)and 18 moreTransport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 34.3)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 32.3)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 30.2)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 30.2)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 29.4)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 28.6)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 28.6)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 28.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 26.6)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 26.3)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 26.3)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 25.3)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 20)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 19.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 13.8)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 13)Protein synthesis Translation factors ribosome recycling factor (TIGR00496; HMM-score: 12.4)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 12)
- TheSEED:
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 22.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7081
- Cytoplasmic Membrane Score: 0.2341
- Cell wall & surface Score: 0.0011
- Extracellular Score: 0.0567
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005414
- TAT(Tat/SPI): 0.000206
- LIPO(Sec/SPII): 0.000917
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_109701449 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MPSGLYKIDTGKVLFDGVNINQIDKKILSQNLGVVPQDSFLLNRSILDNITLKH
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]