Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae JJA
- locus tag: SPJ_0112 [new locus tag: SPJ_RS11380 ]
- pan locus tag?: PNEUPAN000717000
- symbol: SPJ_0112
- pan gene symbol?: tnp (pseudogene)
- synonym:
- product: transposase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPJ_0112 [new locus tag: SPJ_RS11380 ]
- symbol: SPJ_0112
- product: transposase
- replicon: chromosome
- strand: +
- coordinates: 98136..98294
- length: 159
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP000919 (98136..98294) NCBI
- BioCyc: see SPJ_RS11380
- MicrobesOnline: 7478395 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_2093 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCATATTCAATAGATTTTCGTAAAAAAGTTCTCTCTTATTGTGAGCGAACAGGTAGT
ATAACAGAAGCATCACACGTTTTCCAAATCTCACGTAATACCATTTATGGCTGGTTAAAG
CTAAAAGAGAAAACAGGAGAGCTAAACCACCAAGTATAG60
120
159
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPJ_0112 [new locus tag: SPJ_RS11380 ]
- symbol: SPJ_0112
- description: transposase
- length: 52
- theoretical pI: 9.66207
- theoretical MW: 6077.93
- GRAVY: -0.467308
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Mobile element protein
- PFAM: HTH (CL0123) HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 50.2)and 12 moreHTH_28; Helix-turn-helix domain (PF13518; HMM-score: 33.5)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 21.9)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 17.8)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 17.5)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 15)HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 14.3)HTH_22; HTH domain (PF13309; HMM-score: 13.9)no clan defined DUF658; Protein of unknown function (DUF658) (PF04936; HMM-score: 13.3)HTH (CL0123) HTH_30; PucR C-terminal helix-turn-helix domain (PF13556; HMM-score: 13.1)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 12.6)HTH_psq; helix-turn-helix, Psq domain (PF05225; HMM-score: 12.1)DUF1804; Protein of unknown function (DUF1804) (PF08822; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9823
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.0162
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.013741
- TAT(Tat/SPI): 0.001478
- LIPO(Sec/SPII): 0.004866
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKTGELNHQV
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2093 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]