Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN032672
- locus tag: SPN032672_RS03285
- pan locus tag?: PNEUPAN003138000
- symbol: SPN032672_RS03285
- pan gene symbol?: ABC-NBD_19
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN032672_RS03285
- symbol: SPN032672_RS03285
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 626081..626776
- length: 696
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_021003 (626081..626776) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1525 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGTCATTACTAGTATTTGAAAATGTATCCAAATCATATGGAGCAACACCAGCCCTTGAA
AATGTTTCTCTTGACATTCCAGCTGGAAAAATTGTCGGCCTTCTTGGGCCAAACGGCTCA
GGAAAAACAACCCTGATTAAACTAATTAATGGCCTCTTACAACCAGATCAAGGACGTGTC
CTCATCAACGACATGGACCCAAGCCCAGCAACCAAGGCCGTTGTAGCTTATTTGCCTGAT
ACGACCTATCTCAATGAGCAAATGAAGGTCAAAGAAGCCCTAACCTACTTCAAGACCTTC
TATAAAGATTTCAATCTTGAACGCGCTCATCATCTACTTGCAGACCTGGGCATTGATGAA
AATAGTCGTCTCAAGAAACTATCAAAAGGAAACAAAGAAAAGGTTCAACTGATTTTGGTT
ATGAGCCGTGATGCTCGTCTCTATGTTTTGGATGAACCCATTGGTGGGGTGGATCCAGCA
GCCCGTGCTTATATCCTCAATACCATTATCAACAACTACTCACCAACTTCTACCGTTTTG
ATTTCTACCCACTTGATTTCTGATATCGAGCCAATCTTGGATGAAATTGTCTTCCTAAAA
GACGGAAAAGTCGTCCGTCAAGGAAATGTAGATGATATTCGCTACGAGTCAGGTGAATCC
ATTGACCAACTCTTCCGTCAGGAATTTAAGGCCTAA60
120
180
240
300
360
420
480
540
600
660
696
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN032672_RS03285
- symbol: SPN032672_RS03285
- description: ABC transporter ATP-binding protein
- length: 231
- theoretical pI: 5.37904
- theoretical MW: 25608.3
- GRAVY: -0.122511
⊟Function[edit | edit source]
- TIGRFAM: gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 139.4)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 125.2)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 122.9)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 119.3)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 119.3)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 113.8)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 111.9)and 74 moreCellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 101.1)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 101.1)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 99.6)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 99.6)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 99.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 97.2)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 95.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 95.7)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 95)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 94.7)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 88.3)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 87.7)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 82.6)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 81.1)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 81.1)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 80.6)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 79.2)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 78.6)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 78.5)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 77.4)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 77)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 76.3)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 74.1)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 73.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 72.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 71.7)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 71.1)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 70.6)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 69.4)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 69.4)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 69.4)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 67.2)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 64.9)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.8)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 63.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 63.2)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 63.2)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 63)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 63)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 62.2)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 62)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59.6)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59.6)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 59.6)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 59.6)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 59.5)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 58.2)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 54.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 54.5)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 54.1)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 53.6)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 53.4)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 51.8)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 51.8)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 51.5)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 49.6)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 49)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 49)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 46)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 42.5)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 38.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 27.4)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 19.5)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 18.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 18.3)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.9)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 14.9)Unknown function General Mg chelatase-like protein (TIGR00368; HMM-score: 13.7)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 12.4)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 12.3)Protein synthesis tRNA and rRNA base modification tRNA threonylcarbamoyl adenosine modification protein YjeE (TIGR00150; HMM-score: 11.8)DNA metabolism DNA replication, recombination, and repair protein RecA (TIGR02012; HMM-score: 11.6)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 10.2)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 10.2)
- TheSEED: data available for D39, Hungary19A-6
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 95.3)and 29 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 48.1)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 24)AAA_23; AAA domain (PF13476; HMM-score: 20.3)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 19.8)AAA_15; AAA ATPase domain (PF13175; HMM-score: 18.8)DLIC; Dynein light intermediate chain (DLIC) (PF05783; HMM-score: 18.2)AAA_16; AAA ATPase domain (PF13191; HMM-score: 17.3)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 15.3)AAA_14; AAA domain (PF13173; HMM-score: 15.2)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 14.9)AAA_22; AAA domain (PF13401; HMM-score: 14.6)AAA_30; AAA domain (PF13604; HMM-score: 14.5)DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 13.8)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.7)AAA_24; AAA domain (PF13479; HMM-score: 13.7)CbiA; CobQ/CobB/MinD/ParA nucleotide binding domain (PF01656; HMM-score: 13.2)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 13.2)AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 13.1)AAA_18; AAA domain (PF13238; HMM-score: 13.1)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 13)H2TH (CL0303) Ribosomal_S13; Ribosomal protein S13/S18 (PF00416; HMM-score: 12.8)P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.5)Mg_chelatase; Magnesium chelatase, subunit ChlI (PF01078; HMM-score: 12.2)KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 12.2)RecA; recA bacterial DNA recombination protein (PF00154; HMM-score: 12)SRP54; SRP54-type protein, GTPase domain (PF00448; HMM-score: 11.9)NACHT; NACHT domain (PF05729; HMM-score: 11.9)NB-ARC; NB-ARC domain (PF00931; HMM-score: 11.7)AAA_13; AAA domain (PF13166; HMM-score: 11)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.2456
- Cytoplasmic Membrane Score: 0.745
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0093
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011039
- TAT(Tat/SPI): 0.000662
- LIPO(Sec/SPII): 0.002152
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000055451 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSLLVFENVSKSYGATPALENVSLDIPAGKIVGLLGPNGSGKTTLIKLINGLLQPDQGRVLINDMDPSPATKAVVAYLPDTTYLNEQMKVKEALTYFKTFYKDFNLERAHHLLADLGIDENSRLKKLSKGNKEKVQLILVMSRDARLYVLDEPIGGVDPAARAYILNTIINNYSPTSTVLISTHLISDIEPILDEIVFLKDGKVVRQGNVDDIRYESGESIDQLFRQEFKA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1525 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]