Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN032672
- locus tag: SPN032672_RS06760
- pan locus tag?: PNEUPAN000736000
- symbol: SPN032672_RS06760
- pan gene symbol?: ptvR
- synonym: ywzG
- product: PadR family transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN032672_RS06760
- symbol: SPN032672_RS06760
- product: PadR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 1259626..1259952
- length: 327
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_021003 (1259626..1259952) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0096 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTACTTTCCAACATCCTCTGCCTTGATTGAATTTCTCATCTTGGCTGTACTGGAGCAG
GGTGATTCTTATGGTTATGAGATTAGCCAAACCATTAAGCTGATCGCTAATATCAAAGAA
TCCACACTCTATCCCATTCTCAAAAAATTGGAAGGCAATAGCTTTCTGACAACCTATTCT
AGAGAGTTCCAAGGTCGCATGCGCAAATACTACTCCTTGACAAACGGTGGTATAGAGCAG
CTCTTGACCCTAAAAGATGAATGGACACTCTATACAGACACCATCAATGGCATCATAGAA
GGGAGTATCCGCCATGACAAGAACTGA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN032672_RS06760
- symbol: SPN032672_RS06760
- description: PadR family transcriptional regulator
- length: 108
- theoretical pI: 5.12032
- theoretical MW: 12425.1
- GRAVY: -0.237037
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 54.5)and 1 moreRegulatory functions DNA interactions poly-beta-hydroxybutyrate-responsive repressor (TIGR02719; HMM-score: 20.3)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: HTH (CL0123) PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 62.1)and 2 moreHTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 14.3)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- genes regulated by
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.963
- Cytoplasmic Membrane Score: 0.0094
- Cell wall & surface Score: 0.002
- Extracellular Score: 0.0256
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.115303
- TAT(Tat/SPI): 0.001589
- LIPO(Sec/SPII): 0.022061
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000273864 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MYFPTSSALIEFLILAVLEQGDSYGYEISQTIKLIANIKESTLYPILKKLEGNSFLTTYSREFQGRMRKYYSLTNGGIEQLLTLKDEWTLYTDTINGIIEGSIRHDKN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0096 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]