Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 20-DEC-2020
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN034156
- locus tag: SPN034156_RS00165 [old locus tag: SPN034156_00350 ]
- pan locus tag?: PNEUPAN002050000
- symbol: SPN034156_RS00165
- pan gene symbol?: pezA
- synonym:
- product: helix-turn-helix domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN034156_RS00165 [old locus tag: SPN034156_00350 ]
- symbol: SPN034156_RS00165
- product: helix-turn-helix domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 29148..29624
- length: 477
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_021006 (29148..29624) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0930 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGATTGGAAAGAACATAAAATCCTTACGTAAAACACATGACTTAACACAACACGAATTT
GCACGGATTATAGGTATTTCACGAAATAGTCTGAGTCGTTATGAAAATGGAACGAGTTCA
GTCTCTACCGAATTAATAGACATCATTTGTCAGAAGTTTAATGTATCTTATGTCGATATT
GTAGGAGAAGATAAAATGCTCAATCCTGTTGAAGATTATGAATTGACTTTGAAAATTGAA
ATTGTGAAAGAAAGAGGTGCTAATCTATTATCTCGACTCTATCGTTATCAAGATAGTCAG
GGAATTAGCATTGATGATGAATCTAATCCTTGGATTTTAATGAGTGATGATCTATCTGAC
TTGATTCAGACAAATATCTATTTAGTAGAAAATTTTGATGAAATAGAGAGATATAGCGGC
TATTTGGATGGAATTGAACGTATGTTAGAGATATCTGAAAAGCGGATGGTAGCTTAA60
120
180
240
300
360
420
477
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN034156_RS00165 [old locus tag: SPN034156_00350 ]
- symbol: SPN034156_RS00165
- description: helix-turn-helix domain-containing protein
- length: 158
- theoretical pI: 4.41891
- theoretical MW: 18289.6
- GRAVY: -0.370886
⊟Function[edit | edit source]
- TIGRFAM: putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 39.9)Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 35.7)and 6 moreMobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.8)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.8)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.8)Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 12.5)RNA polymerase sigma-70 factor, sigma-B/F/G subfamily (TIGR02980; HMM-score: 12.5)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 12.4)
- TheSEED: data available for D39
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 53.2)and 9 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 38.6)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 34.8)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 33.7)MqsA_antitoxin; Antitoxin component of bacterial toxin-antitoxin system, MqsA (PF15731; HMM-score: 26.7)HTH_60; Helix-turn-helix domain (PF20317; HMM-score: 19.4)Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 19.1)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 14.9)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.4)Nckap1_CYFIP1-2 (CL0715) Nckap1; Nck-associated protein 1 (PF09735; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006494
- TAT(Tat/SPI): 0.001073
- LIPO(Sec/SPII): 0.00127
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000579602 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIGKNIKSLRKTHDLTQHEFARIIGISRNSLSRYENGTSSVSTELIDIICQKFNVSYVDIVGEDKMLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIQTNIYLVENFDEIERYSGYLDGIERMLEISEKRMVA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0930 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.