Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 06-FEB-2015
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F02290
- pan locus tag?:
- symbol: SPN23F02290
- pan gene symbol?: —
- synonym:
- product: putative permease component of ABC transporter
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F02290
- symbol: SPN23F02290
- product: putative permease component of ABC transporter
- replicon: chromosome
- strand: -
- coordinates: 208669..209082
- length: 414
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FM211187 (208669..209082) NCBI
- BioCyc:
- MicrobesOnline: 5830117 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGATTACAGGGACTGCTTTCATCTTGATTATGTCTCTATCTGCCAGAAAATTACCTTAT
ACTATTCGCTCATCTGTTGCTAGCTTACAACAAATAGCACCAAGTATTGAAGAAGCTGCT
GAAAGCTTAGGAAGTAGTCGTCTCAATATCTTTGCTAAGATTACAACTCCAATGATGCTA
TCGGATATTATTTCTGGAGCCATCCTATCTTGGGTCACACTGATTTCAGAACTCTCTACT
TCTATCCTCCTCTACAATGTCAAAACAAGAACAATGACTGTAGCTATTTATACAGAGGTT
CTCAGAGGAAATTACGGTGTAGCTGCAGCCTTGTCAACTATCCTGACTGTTCTAACAGTA
GGTTCCTTGCTCTTGTTTATGAAAATCTCTAAAAGCAATAGCATTACACTTTAG60
120
180
240
300
360
414
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F02290
- symbol: SPN23F02290
- description: putative permease component of ABC transporter
- length: 137
- theoretical pI: 10.144
- theoretical MW: 14705.4
- GRAVY: 0.756934
⊟Function[edit | edit source]
- TIGRFAM: NifC-like ABC-type porter (TIGR01581; HMM-score: 62.3)Transport and binding proteins Anions molybdate ABC transporter, permease protein (TIGR02141; HMM-score: 59.9)and 9 more2-aminoethylphosphonate ABC transport system, membrane component PhnV (TIGR03255; HMM-score: 48.8)Transport and binding proteins Anions sulfate ABC transporter, permease protein (TIGR00969; HMM-score: 44.6)2-aminoethylphosphonate ABC transporter, permease protein (TIGR03226; HMM-score: 43)Transport and binding proteins Anions sulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 42.5)Transport and binding proteins Anions sulfate ABC transporter, permease protein CysW (TIGR02140; HMM-score: 39.9)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, permease protein (TIGR03262; HMM-score: 37.5)Transport and binding proteins Anions phosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 24.8)choline ABC transporter, permease protein (TIGR03416; HMM-score: 16.2)Transport and binding proteins Anions phosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 15.2)
- TheSEED :
- Ferric iron ABC transporter, permease protein
- PFAM: BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 33.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.01
- Cytoplasmic Membrane Score: 9.99
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9998
- Cell wall & surface Score: 0
- Extracellular Score: 0.0002
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.084365
- TAT(Tat/SPI): 0.009822
- LIPO(Sec/SPII): 0.030702
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CAR68089 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MITGTAFILIMSLSARKLPYTIRSSVASLQQIAPSIEEAAESLGSSRLNIFAKITTPMMLSDIISGAILSWVTLISELSTSILLYNVKTRTMTVAIYTEVLRGNYGVAAALSTILTVLTVGSLLLFMKISKSNSITL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]