Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 06-FEB-2015
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F13630
- pan locus tag?:
- symbol: SPN23F13630
- pan gene symbol?: —
- synonym:
- product: putative phosphate ABC transporter permease protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F13630
- symbol: SPN23F13630
- product: putative phosphate ABC transporter permease protein
- replicon: chromosome
- strand: -
- coordinates: 1336244..1336693
- length: 450
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FM211187 (1336244..1336693) NCBI
- BioCyc:
- MicrobesOnline: 5831204 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421TTGTCAGGGATTTCCGTCCTCTTTGTCATGATTTTGCCGACCGTAACCTTTATGACAACG
GATAGCTTGCGTGCGGTTCCTCGTTATTATCGTGAGGCCAGTTTCGCTATGGGAGCCACT
CGCTGGCAGACTATCTGGCGTGTGATCTTGAAGGCGGCCCGTTCTGGTATTTTCACTGCA
GTGGTCTTTGGGATGGCGCGTGCCTTTGGTGAGGCTTTAGCTATCCAGATGGTTGTCGGA
AACTCAGCTGTTATCCCAACTTCCTTGACCACACCAGCTGCAACTTTAACTTCTATATTA
ACTATGGGAATTGGGAACACTGTCATGGGAACTGTAAATAATAATGTTCTCTGGTCACTG
GCCTTGGTACTGCTCTTGATGAGTTTAGTTTTTAACAGTGTGATTAAATTGATTACGAAA
GAAAGAGGAAAGAAAAATTATGCGCGCTAA60
120
180
240
300
360
420
450
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F13630
- symbol: SPN23F13630
- description: putative phosphate ABC transporter permease protein
- length: 149
- theoretical pI: 11.8042
- theoretical MW: 16194.3
- GRAVY: 0.674497
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Anions phosphate ABC transporter, permease protein PstC (TIGR02138; HMM-score: 160.4)and 9 moreTransport and binding proteins Anions phosphate ABC transporter, permease protein PstA (TIGR00974; HMM-score: 97.1)Transport and binding proteins Anions sulfate ABC transporter, permease protein (TIGR00969; HMM-score: 45.3)Transport and binding proteins Anions molybdate ABC transporter, permease protein (TIGR02141; HMM-score: 38.8)Transport and binding proteins Anions sulfate ABC transporter, permease protein CysT (TIGR02139; HMM-score: 34.7)NifC-like ABC-type porter (TIGR01581; HMM-score: 29.6)Transport and binding proteins Anions sulfate ABC transporter, permease protein CysW (TIGR02140; HMM-score: 27.8)choline ABC transporter, permease protein (TIGR03416; HMM-score: 18.2)2-aminoethylphosphonate ABC transporter, permease protein (TIGR03226; HMM-score: 18)Transport and binding proteins Anions nitrate ABC transporter, permease protein (TIGR01183; HMM-score: 16.5)
- TheSEED :
- Phosphate transport system permease protein PstC (TC 3.A.1.7.1)
Phosphorus Metabolism Phosphorus Metabolism - no subcategory High affinity phosphate transporter and control of PHO regulon Phosphate transport system permease protein PstC (TC 3.A.1.7.1)and 1 more - PFAM: BPD_transp_1 (CL0404) BPD_transp_1; Binding-protein-dependent transport system inner membrane component (PF00528; HMM-score: 73.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9999
- Cell wall & surface Score: 0
- Extracellular Score: 0.0001
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.200108
- TAT(Tat/SPI): 0.006908
- LIPO(Sec/SPII): 0.017035
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CAR69163 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSGISVLFVMILPTVTFMTTDSLRAVPRYYREASFAMGATRWQTIWRVILKAARSGIFTAVVFGMARAFGEALAIQMVVGNSAVIPTSLTTPAATLTSILTMGIGNTVMGTVNNNVLWSLALVLLLMSLVFNSVIKLITKERGKKNYAR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: phoU < pstB1 < pstB2 < SPN23F13620 < SPN23F13630 < SPN23F13640 < pstS < SPN23F13670 < SPN23F13680 < SPN23F13690 < spxA
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]