From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 06-FEB-2015

Summary[edit | edit source]

  • organism: Streptococcus pneumoniae ATCC 700669
  • locus tag: SPN23F20400 [new locus tag: SPN23F_RS10465 ]
  • pan locus tag?: PNEUPAN003651000
  • symbol: SPN23F20400
  • pan gene symbol?:
  • synonym:
  • product: putative nucleotide-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SPN23F20400 [new locus tag: SPN23F_RS10465 ]
  • symbol: SPN23F20400
  • product: putative nucleotide-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1982531..1982662
  • length: 132
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAAAGTAGAAAATATTTCGTATAGGGTGGATCATCGTAAATTGTTTGATAATATTTCT
    TTTGATACTTCGAGTTCAGACGTGACATTAATTACTGGTAAAAATGGTACAGGAAAGTCA
    ACTTTACTATAG
    60
    120
    132

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SPN23F20400 [new locus tag: SPN23F_RS10465 ]
  • symbol: SPN23F20400
  • description: putative nucleotide-binding protein
  • length: 43
  • theoretical pI: 9.19021
  • theoretical MW: 4789.36
  • GRAVY: -0.413953

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 30.9)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 30.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 28)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 26.8)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 26.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 26.4)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 25.7)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 25.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 24.8)
    and 46 more
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 23.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 23)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 21.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 20.9)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 20.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 20.7)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 20.4)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 20.3)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 19.9)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 19.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 19.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 19.5)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 18.6)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 18.6)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 18)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 18)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 17.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 17.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 17.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 17.3)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 16.4)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 16)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 15.8)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 15.7)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 15.6)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 15)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 14.1)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 14)
    Metabolism Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 13.9)
    Signal transduction Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 13.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 13.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 13.3)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 13.1)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 12.1)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 12.1)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 12.1)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 12.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 12.1)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 11.7)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 11.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 11.5)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 11.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 11.2)
    Genetic information processing DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 11.2)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 9.8)
  • TheSEED  :
    • ABC transporter, ATP-binding protein
  • PFAM:
    P-loop_NTPase (CL0023) AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 29.7)
    AAA_23; AAA domain (PF13476; HMM-score: 28.2)
    ABC_tran; ABC transporter (PF00005; HMM-score: 27)
    and 13 more
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 17.5)
    AAA_27; AAA domain (PF13514; HMM-score: 17.1)
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 16.1)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 15.8)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.3)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 15.1)
    AAA_30; AAA domain (PF13604; HMM-score: 15.1)
    MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 13.4)
    AAA_22; AAA domain (PF13401; HMM-score: 13.3)
    ATPase; KaiC (PF06745; HMM-score: 13.1)
    AAA_25; AAA domain (PF13481; HMM-score: 13.1)
    NACHT; NACHT domain (PF05729; HMM-score: 12.4)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7638
    • Cytoplasmic Membrane Score: 0.1431
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.093
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.236002
    • TAT(Tat/SPI): 0.01436
    • LIPO(Sec/SPII): 0.013784
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: CAR69788 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKVENISYRVDHRKLFDNISFDTSSSDVTLITGKNGTGKSTLL

Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription[edit | edit source]

  • transcription start site:

Expression data[edit | edit source]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]