Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F_RS07955 [old locus tags: SPN23F15780 SPN23F_15780 ]
- pan locus tag?: PNEUPAN000555000
- symbol: SPN23F_RS07955
- pan gene symbol?: —
- synonym:
- product: ImmA/IrrE family metallo-endopeptidase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F_RS07955 [old locus tags: SPN23F15780 SPN23F_15780 ]
- symbol: SPN23F_RS07955
- product: ImmA/IrrE family metallo-endopeptidase
- replicon: chromosome
- strand: +
- coordinates: 1524874..1525254
- length: 381
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_011900 (1524874..1525254) NCBI
- BioCyc: SPN23F_RS07955 BioCyc
- MicrobesOnline: see SPN23F15780
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGACTGAAAAAGAATTTTCTCAAAATCTAGGCATAGATATAGAGATTTTTGAAGATGGT
CTATTTCCAGATGAAGCCTTTTACATCCCAGCCCTCAAAACTATGTTTTTGAGTGATGCT
ATATCTGATGAAAAAAGGGTACAAGTCGCTTTACATGAGATAGGCCATAGAAACCACGCG
CCAGATACTTATCAGCTTTTTAGGGAAAAGTGTGAGCTTGAGGCTAATAGGAATATGATC
CATCACCTTATGAAAGCTGAGTTGGATATAGCCGAAGATGCCACTACATTTAATTACCTG
GTATTTATGGAAAAGTATAATTTAAAAACCATTGCCGATGAAATCATGGTCAAAGAAGAA
TATTTAGCACTACTTAATTAA60
120
180
240
300
360
381
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F_RS07955 [old locus tags: SPN23F15780 SPN23F_15780 ]
- symbol: SPN23F_RS07955
- description: ImmA/IrrE family metallo-endopeptidase
- length: 126
- theoretical pI: 4.36813
- theoretical MW: 14746.7
- GRAVY: -0.283333
⊟Function[edit | edit source]
- TIGRFAM: M6 family metalloprotease domain (TIGR03296; EC 3.4.24.-; HMM-score: 12.4)
- TheSEED: see SPN23F15780
- PFAM: Peptidase_MA (CL0126) Peptidase_M78; IrrE N-terminal-like domain (PF06114; HMM-score: 26.5)and 2 moreno clan defined DUF6782; Putative metallopeptidase family (DUF6782) (PF20573; HMM-score: 16.5)Peptidase_MA (CL0126) Reprolysin_5; Metallo-peptidase family M12 (PF13688; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.892
- Cytoplasmic Membrane Score: 0.0064
- Cell wall & surface Score: 0.0009
- Extracellular Score: 0.1007
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001872
- TAT(Tat/SPI): 0.000182
- LIPO(Sec/SPII): 0.000159
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000136430 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTEKEFSQNLGIDIEIFEDGLFPDEAFYIPALKTMFLSDAISDEKRVQVALHEIGHRNHAPDTYQLFREKCELEANRNMIHHLMKAELDIAEDATTFNYLVFMEKYNLKTIADEIMVKEEYLALLN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]