Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 11-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae ATCC 700669
- locus tag: SPN23F_RS13700
- pan locus tag?: PNEUPAN000789000
- symbol: SPN23F_RS13700
- pan gene symbol?: —
- synonym:
- product: ATPase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN23F_RS13700
- symbol: SPN23F_RS13700
- product: ATPase
- replicon: chromosome
- strand: +
- coordinates: 123682..124221
- length: 540
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_011900 (123682..124221) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAATAAGAAAAAAATGATTTTAACAAGTCTAGCCAGCGTCGCTATCTTAGGGGCTGGT
TTTGTTGCGTCTTCGCCTACTGTTGTAAGAGCAGAAGACGCTCCACAAGTTGTCGAAAAA
TCTTCATTAGAGAAGAAATATGAGGAAGCAAAAACAAAAGCTGATACTGCCAAGAAAGAT
TACGAAACGGCTAAAAAGAAAGCAGAAGACGCTCAGAAGAAATATGATGAGGATCAGAAG
AAAACTGAAGAGAAAGCGAAAAAAGAGAAAGAAGCTGCTAAGAAAGTAGACGATGCTAGT
TTAGCGGTACAAAAAGCATATGTAGAATATAGAAAAGTTCAAGAATCTCGTAGTAATTAC
AGAAATCGGAGTGATTATAATAAAAAATTAGCAGAGGCGCAAGTAAAAATAGATGAAGCG
AATAAAAAACTAACCGCAGCTAATAATGAGTTTAAAACTGTAAGAGCAGTTGTAGTTCCT
GAACCAAATGCGTTGGCTGAGACTAAGAAAAAAGCAGAAGAAGCTAAAGCAGAAAAGTAG60
120
180
240
300
360
420
480
540
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN23F_RS13700
- symbol: SPN23F_RS13700
- description: ATPase
- length: 179
- theoretical pI: 10.0687
- theoretical MW: 20017.6
- GRAVY: -1.06425
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 16)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 16)and 12 moreSH3 domain protein (TIGR04211; HMM-score: 12)SEC10/PgrA surface exclusion domain (TIGR04320; HMM-score: 10.3)Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 8.7)DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 7.8)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 7.3)oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 7)DNA metabolism Restriction/modification DNA sulfur modification protein DndD (TIGR03185; HMM-score: 6.9)Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 6.5)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 6.5)Cellular processes Pathogenesis type VI secretion protein IcmF (TIGR03348; HMM-score: 6.2)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 3.4)Hypothetical proteins Conserved TIGR02680 family protein (TIGR02680; HMM-score: 3.3)
- TheSEED:
- PFAM: no clan defined DUF3450; Protein of unknown function (DUF3450) (PF11932; HMM-score: 13.4)LMBR1; LMBR1-like membrane protein (PF04791; HMM-score: 11.1)SpoIIIAH; SpoIIIAH-like protein (PF12685; HMM-score: 11.1)and 7 moreGT-B (CL0113) FUT8_N_cat; Alpha-(1,6)-fucosyltransferase N- and catalytic domains (PF19745; HMM-score: 8)no clan defined Phlebovirus_NSM; Phlebovirus nonstructural protein NS-M (PF07246; HMM-score: 7.4)His_Kinase_A (CL0025) HisKA_3; Histidine kinase (PF07730; HMM-score: 7.3)BCLiA (CL0551) ATG14; Vacuolar sorting 38 and autophagy-related subunit 14 (PF10186; HMM-score: 7)Golgi-transport (CL0145) IMD; IRSp53/MIM homology domain (PF08397; HMM-score: 6.7)no clan defined Neur_chan_memb; Neurotransmitter-gated ion-channel transmembrane region (PF02932; HMM-score: 6.3)V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cell wall & surface
- Cytoplasmic Score: 0.0009
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0.7548
- Extracellular Score: 0.2437
- SignalP: Signal peptide SP(Sec/SPI) length 31 aa
- SP(Sec/SPI): 0.994729
- TAT(Tat/SPI): 0.002512
- LIPO(Sec/SPII): 0.002305
- Cleavage Site: CS pos: 31-32. VRA-ED. Pr: 0.9712
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_231844674 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNKKKMILTSLASVAILGAGFVASSPTVVRAEDAPQVVEKSSLEKKYEEAKTKADTAKKDYETAKKKAEDAQKKYDEDQKKTEEKAKKEKEAAKKVDDASLAVQKAYVEYRKVQESRSNYRNRSDYNKKLAEAQVKIDEANKKLTAANNEFKTVRAVVVPEPNALAETKKKAEEAKAEK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]