Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 24-FEB-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN994038
- locus tag: SPN994038_RS06610 [old locus tag: SPN994038_12330 ]
- pan locus tag?: PNEUPAN002689000
- symbol: rpsU
- pan gene symbol?: rpsU
- synonym:
- product: 30S ribosomal protein S21
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN994038_RS06610 [old locus tag: SPN994038_12330 ]
- symbol: rpsU
- product: 30S ribosomal protein S21
- replicon: chromosome
- strand: -
- coordinates: 1254846..1255022
- length: 177
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_021026 (1254846..1255022) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1245 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGTCTAAAACAGTAGTACGTAAGAATGAATCTCTTGACGACGCACTTCGCCGTTTCAAA
CGTGCGGTTACTAAAGCTGGTACTCTTCAAGAAACACGCAAACGTGAATTCTATGAAAAA
CCTTCTGTAAAACGTAAACGTAAATCAGAAGTAGCTCGTAAACGTAAAAAATTCTAA60
120
177
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN994038_RS06610 [old locus tag: SPN994038_12330 ]
- symbol: RpsU
- description: 30S ribosomal protein S21
- length: 58
- theoretical pI: 11.8806
- theoretical MW: 6998.17
- GRAVY: -1.42586
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS21 (TIGR00030; HMM-score: 72)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined Ribosomal_S21; Ribosomal protein S21 (PF01165; HMM-score: 70.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6258
- Cytoplasmic Membrane Score: 0.0008
- Cell wall & surface Score: 0
- Extracellular Score: 0.3734
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.015079
- TAT(Tat/SPI): 0.011363
- LIPO(Sec/SPII): 0.01088
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000048055 NCBI
- UniProt:
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEVARKRKKF
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1245 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]