Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 26-AUG-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPN994039
- locus tag: SPN994039_16740 [new locus tag: SPN994039_RS09145 ]
- pan locus tag?: PNEUPAN003465000
- symbol: groES
- pan gene symbol?: groES
- synonym:
- product: 10 kDa chaperonin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPN994039_16740 [new locus tag: SPN994039_RS09145 ]
- symbol: groES
- product: 10 kDa chaperonin
- replicon: chromosome
- strand: -
- coordinates: 1701575..1701859
- length: 285
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312044 (1701575..1701859) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1710 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTTGAAACCATTAGGGGACCGTGTGCTCTTAAAAATAGAAGAAAAAGAACAAACCGTT
GGGGGCTTTGTCCTTGCAGGCTCAGCCCAAGAAAAAACCAAAACAGCTCAAGTTGTGGCT
ACTGGACAAGGTGTTCGTACCTTGAACGGTGACTTGGTTGCTCCAAGTGTTAAAACTGGA
GATCGTGTCTTAGTTGAAGCCCACGCAGGTCTTGATGTCAAAGATGGCGATGAAAAGTAC
ATCATCGTAGGCGAAGCTAACATTTTGGCAATCATTGAGGAATAG60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPN994039_16740 [new locus tag: SPN994039_RS09145 ]
- symbol: GroES
- description: 10 kDa chaperonin
- length: 94
- theoretical pI: 4.64142
- theoretical MW: 9926.32
- GRAVY: 0.00212766
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: GroES (CL0296) Cpn10; Chaperonin 10 Kd subunit (PF00166; HMM-score: 82.1)and 2 moreno clan defined HupF_HypC; HupF/HypC family (PF01455; HMM-score: 14.6)DUF3540; Protein of unknown function (DUF3540) (PF12059; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9984
- Cytoplasmic Membrane Score: 0.0001
- Cell wall & surface Score: 0
- Extracellular Score: 0.0014
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.01588
- TAT(Tat/SPI): 0.007668
- LIPO(Sec/SPII): 0.003776
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCP35368 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MLKPLGDRVLLKIEEKEQTVGGFVLAGSAQEKTKTAQVVATGQGVRTLNGDLVAPSVKTGDRVLVEAHAGLDVKDGDEKYIIVGEANILAIIEE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1710 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]