Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 27-FEB-2015
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPNA45
- locus tag: SPNA45_00058 [new locus tag: SPNA45_RS00350 ]
- pan locus tag?: PNEUPAN000495000
- symbol: SPNA45_00058
- pan gene symbol?: —
- synonym:
- product: Phage endolysin
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNA45_00058 [new locus tag: SPNA45_RS00350 ]
- symbol: SPNA45_00058
- product: Phage endolysin
- replicon: chromosome
- strand: +
- coordinates: 56940..57356
- length: 417
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: HE983624 (56940..57356) NCBI
- BioCyc: see SPNA45_RS00350
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCAAATTGAATTTTTCAATTTTCTAAGAAGTGTCGTACAGACTGAAGATGGTTTGGTA
TTGTACGCTCTAGCACTGATTGTCTCAATGGAAATCATTGATTTTGTGACAGGGACGATT
GCGGCGATTATCAATCCTGACATCGAGTACAAGAGCAAAATCGGCATTAACGGGCTCCTT
CGTAAGATTTCAGGGGTTCTCTTACTGATGATCCTCATTCCGGCGTCCGTTTTGTTGCCT
GAAAAGACAGGTTTTGCATTCTTGTACTCAATCTATCTAGGGTACATCGCATTTACTTTT
CAATCTCTCATTGAAAATTACCGCAAATTAAAAGGAAATGTTACTCTTTTTCAGCCGATT
GTAAAAGTATTTCAGCGATTACTTGAAAAAGATGATGATACGAAAAAAGGAGAATAA60
120
180
240
300
360
417
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNA45_00058 [new locus tag: SPNA45_RS00350 ]
- symbol: SPNA45_00058
- description: Phage endolysin
- length: 138
- theoretical pI: 6.84505
- theoretical MW: 15598.4
- GRAVY: 0.518116
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions toxin secretion/phage lysis holin (TIGR01593; HMM-score: 115.8)Protein fate Protein and peptide secretion and trafficking toxin secretion/phage lysis holin (TIGR01593; HMM-score: 115.8)and 2 moreProtein fate Protein modification and repair cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 9)Energy metabolism Electron transport cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 9)
- TheSEED: data available for Hungary19A-6
- PFAM: no clan defined Phage_holin_4_1; Bacteriophage holin family (PF05105; HMM-score: 48)and 1 moreTgpA_N; TgpA N-terminal domain (PF11992; HMM-score: 11.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9982
- Cell wall & surface Score: 0
- Extracellular Score: 0.0017
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010304
- TAT(Tat/SPI): 0.000383
- LIPO(Sec/SPII): 0.000683
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCM07348 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MQIEFFNFLRSVVQTEDGLVLYALALIVSMEIIDFVTGTIAAIINPDIEYKSKIGINGLLRKISGVLLLMILIPASVLLPEKTGFAFLYSIYLGYIAFTFQSLIENYRKLKGNVTLFQPIVKVFQRLLEKDDDTKKGE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]