Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 27-FEB-2015
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae SPNA45
- locus tag: SPNA45_00891 [new locus tag: SPNA45_RS05060 ]
- pan locus tag?: PNEUPAN002588000
- symbol: rplS
- pan gene symbol?: rplS
- synonym:
- product: 50S ribosomal protein L19
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNA45_00891 [new locus tag: SPNA45_RS05060 ]
- symbol: rplS
- product: 50S ribosomal protein L19
- replicon: chromosome
- strand: +
- coordinates: 873123..873470
- length: 348
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: HE983624 (873123..873470) NCBI
- BioCyc: see SPNA45_RS05060
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1148 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAATCCATTAATCCAAAGCTTGACTGAAGGTCAACTTCGTACAGATATCCCATCATTC
CGTCCTGGTGACACTGTTCGTGTACATGCGAAAGTTGTCGAAGGTAACCGTGAACGTATC
CAGATTTTTGAAGGTGTTGTTATTGCACGTAAAGGTGCTGGCATCTCTGAAAACTACACA
GTTCGTAAAATCTCTAACGGTGTAGGTGTTGAGCGTATCTTCCCAATCCACACTCCACGT
GTTGAAAAAATCGAAGTTGTACGTTACGGTAAAGTACGTCGTGCGAAATTGTACTACTTG
CGTGCTCTTCAAGGTAAGGCAGCTCGTATCAAAGAAATCCGTCGTTAA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNA45_00891 [new locus tag: SPNA45_RS05060 ]
- symbol: RplS
- description: 50S ribosomal protein L19
- length: 115
- theoretical pI: 11.5051
- theoretical MW: 13136.3
- GRAVY: -0.397391
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL19 (TIGR01024; HMM-score: 166.6)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: KOW (CL0107) Ribosomal_L19; Ribosomal protein L19 (PF01245; HMM-score: 175.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.602
- Cytoplasmic Membrane Score: 0.0015
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.3965
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007837
- TAT(Tat/SPI): 0.001356
- LIPO(Sec/SPII): 0.001206
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CCM08177 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGNRERIQIFEGVVIARKGAGISENYTVRKISNGVGVERIFPIHTPRVEKIEVVRYGKVRRAKLYYLRALQGKAARIKEIRR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1148 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]