Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 03-APR-2017
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hu15
- locus tag: SPNHU15_00935 [new locus tag: SPNHU15_RS10920 ]
- pan locus tag?: PNEUPAN000084000
- symbol: SPNHU15_00935
- pan gene symbol?: —
- synonym:
- product: Type I restriction-modification system, specificity subunit S
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNHU15_00935 [new locus tag: SPNHU15_RS10920 ]
- symbol: SPNHU15_00935
- product: Type I restriction-modification system, specificity subunit S
- replicon: chromosome
- strand: +
- coordinates: 881528..881725
- length: 198
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: CP020551 (881528..881725) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGATATCAGGAAGTGCTCAGCCTCAGTTACCAATTACAAAATTAAAAAAAATACTTCTC
CCCCTCCCCCCACTAGCCCTCCAAAATGAGTTCGCAGACTTTGTAGTCCAGGTCGACAAA
TCTAAATTGGCAATCCAAAAATCTCTGGAAGAACTTGAAACTTTGAAGAAATCTCTGATG
CAGGAGTATTTTGGCTGA60
120
180
198
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNHU15_00935 [new locus tag: SPNHU15_RS10920 ]
- symbol: SPNHU15_00935
- description: Type I restriction-modification system, specificity subunit S
- length: 65
- theoretical pI: 9.09262
- theoretical MW: 7298.64
- GRAVY: -0.00153846
⊟Function[edit | edit source]
- reaction: EC 3.1.21.3? ExPASyType I site-specific deoxyribonuclease Endonucleolytic cleavage of DNA to give random double-stranded fragments with terminal 5'-phosphates; ATP is simultaneously hydrolyzed
- TIGRFAM: Energy metabolism TCA cycle fumarate hydratase, class II (TIGR00979; EC 4.2.1.2; HMM-score: 14.6)
- TheSEED: data available for TIGR4
- PFAM: TRD (CL0477) Methylase_S; Type I restriction modification DNA specificity domain (PF01420; HMM-score: 28)and 1 moreRNase_H (CL0219) RT_RNaseH_2; RNase H-like domain found in reverse transcriptase (PF17919; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.4107
- Cytoplasmic Membrane Score: 0.0296
- Cell wall & surface Score: 0.0016
- Extracellular Score: 0.5581
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010346
- TAT(Tat/SPI): 0.000219
- LIPO(Sec/SPII): 0.001594
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: ARD36726 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MISGSAQPQLPITKLKKILLPLPPLALQNEFADFVVQVDKSKLAIQKSLEELETLKKSLMQEYFG
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]