Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 07-MAR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hu15
- locus tag: SPNHU15_RS00040 [old locus tag: SPNHU15_00008 ]
- pan locus tag?: PNEUPAN000363000
- symbol: SPNHU15_RS00040
- pan gene symbol?: divIC
- synonym: ftsB
- product: septum formation initiator family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNHU15_RS00040 [old locus tag: SPNHU15_00008 ]
- symbol: SPNHU15_RS00040
- product: septum formation initiator family protein
- replicon: chromosome
- strand: +
- coordinates: 8778..9146
- length: 369
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NZ_CP020551 (8778..9146) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0008 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCTAAAAATATTGTACAATTGAATAATTCTTTTATTCAAAATGAATACCAACGTCGT
CGCTACCTGATGAAAGAACGACAAAAACGGAATCGTTTTATGGGAGGGGTATTGATTTTG
ATTATGCTATTATTTATCTTGCCAACTTTTAATTTAGCGCAGAGTTATCAGCAATTACTC
CAAAGACGTCAGCAATTAGCAGACTTGCAAACTCAGTATCAAACTTTGAGTGATGAAAAG
GATAAGGAGACAGCATTTGCTACCAAGTTGAAAGATGAAGATTATGCTGCTAAATATACA
CGAGCGAAGTACTATTATTCTAAGTCGAGGGAAAAAGTTTATACGATTCCTGACTTGCTT
CAAAGGTGA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNHU15_RS00040 [old locus tag: SPNHU15_00008 ]
- symbol: SPNHU15_RS00040
- description: septum formation initiator family protein
- length: 122
- theoretical pI: 10.3171
- theoretical MW: 14805
- GRAVY: -0.790984
⊟Function[edit | edit source]
- TIGRFAM: PfaB family protein (TIGR02816; HMM-score: 11.3)and 1 moreSH3 domain protein (TIGR04211; HMM-score: 6.3)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: FtsL (CL0225) DivIC; Septum formation initiator (PF04977; HMM-score: 66.5)and 7 moreTPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.9)no clan defined TERF2_RBM; Telomeric repeat-binding factor 2 Rap1-binding motif (PF16772; HMM-score: 13)DUF5564; Family of unknown function (DUF5564) (PF17719; HMM-score: 12.8)O-anti_assembly (CL0499) O-antigen_lig; O-antigen ligase like membrane protein (PF13425; HMM-score: 12.4)Wzy_C; O-Antigen ligase (PF04932; HMM-score: 12.2)no clan defined DUF6056; Family of unknown function (DUF6056) (PF19528; HMM-score: 12)SNARE-fusion (CL0445) Synaptobrevin; Synaptobrevin (PF00957; HMM-score: 9.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9954
- Cell wall & surface Score: 0
- Extracellular Score: 0.0045
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.09145
- TAT(Tat/SPI): 0.009393
- LIPO(Sec/SPII): 0.002547
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000041909 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKYYYSKSREKVYTIPDLLQR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0008 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.