Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 07-MAR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hu15
- locus tag: SPNHU15_RS08805 [old locus tag: SPNHU15_01863 ]
- pan locus tag?: PNEUPAN003362000
- symbol: SPNHU15_RS08805
- pan gene symbol?: —
- synonym:
- product: VOC family protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNHU15_RS08805 [old locus tag: SPNHU15_01863 ]
- symbol: SPNHU15_RS08805
- product: VOC family protein
- replicon: chromosome
- strand: +
- coordinates: 1748830..1749081
- length: 252
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP020551 (1748830..1749081) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGGACTACAATGCGGTCATTCCCGAGTTGCTTGTATCGAATATCGAACAGTCCCGGTCC
TTCTACTGTGGTTTACTGGGTTTTAGGATTGAATACCAACGTCCAGAAGAAAACTTTCTC
TTTCTTTCTCTTGAAGAGTGTCAACTAATGTTAGAGGAGGGAACAAAGGATCAACTAGCT
GAACTGACCTATCCATTTGGTCGTGGAGTCAATCTCTCCTTTGGCATAAAGGATGTTTCA
AAACTCTATTAA60
120
180
240
252
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNHU15_RS08805 [old locus tag: SPNHU15_01863 ]
- symbol: SPNHU15_RS08805
- description: VOC family protein
- length: 83
- theoretical pI: 4.15151
- theoretical MW: 9620.93
- GRAVY: -0.116867
⊟Function[edit | edit source]
- TIGRFAM: 3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 20.9)
- TheSEED: data available for Hungary19A-6
- PFAM: Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 16.3)and 2 moreGlyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 12.6)Glyoxalase_7; Glyoxalase superfamily protein (PF19581; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.78
- Cytoplasmic Membrane Score: 8.16
- Cellwall Score: 0.06
- Extracellular Score: 0.01
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9806
- Cytoplasmic Membrane Score: 0.0024
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0168
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003634
- TAT(Tat/SPI): 0.000268
- LIPO(Sec/SPII): 0.000535
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000386134 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MDYNAVIPELLVSNIEQSRSFYCGLLGFRIEYQRPEENFLFLSLEECQLMLEEGTKDQLAELTYPFGRGVNLSFGIKDVSKLY
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]