Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 02-APR-2021
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Hu15
- locus tag: SPNHU15_RS10575 [old locus tag: SPNHU15_02236 ]
- pan locus tag?: PNEUPAN003921000
- symbol: SPNHU15_RS10575
- pan gene symbol?: thiZ
- synonym:
- product: ABC transporter ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNHU15_RS10575 [old locus tag: SPNHU15_02236 ]
- symbol: SPNHU15_RS10575
- product: ABC transporter ATP-binding protein
- replicon: chromosome
- strand: -
- coordinates: 2107488..2108216
- length: 729
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP020551 (2107488..2108216) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_2024 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721ATGACAGAAATTAGACTAGAGCACGTCAGTTATGCCTATGGTCAGGAGAGGATTTTAGAG
GATATCAACCTACAGGTGACTTCAGGCGAAGTGGTTTCCATCCTAGGCCCAAGTGGTGTT
GGAAAGACCACCCTCTTTAATCTAATCGCTGGGATTTTAGAAGTTCAGTCAGGGAGAATT
GTCCTTGATGGTGAAGAAAATCCCAAGGGGCGCGTGAGTTATATGTTGCAAAAGGATCTG
CTCTTGGAGCACAAGACGGTGCTTGGAAATATCATTCTGCCCCTCTTGATTCAAAAGGTG
GATAAGGCAGAAGCTATTTCCCGAGCGGATAAAATTCTTGCGACCTTCCAGCTGACAGCT
GTAAGAGACAAGTATCCTCATGAACTTAGCGGTGGGATGCGCCAGCGTGTAGCCTTACTC
CGGACCTACCTTTTTGGGCACAAGCTCTTTCTCTTAGATGAGGCCTTTAGCGCCTTGGAT
GAGATGACAAAGATGGAACTCCACGCTTGGTATCTTGAGATTCACAAGCAGTTGCAGCTA
ACAACCCTGATCATCACGCATAGTATTGAGGAGGCCCTCAATCTCAGCGACCGCATCTAT
ATCTTGAAAAATCGCCCTGGGCAGATTGTTTCAGAAATTAAACTAGATTGGTCTGAAGAT
GAGGACAAGGAAGTCCAAAAGATTGCCTACAAACGTCAAATCTTGGCAGAATTAGGCTTA
GATAAGTAG60
120
180
240
300
360
420
480
540
600
660
720
729
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNHU15_RS10575 [old locus tag: SPNHU15_02236 ]
- symbol: SPNHU15_RS10575
- description: ABC transporter ATP-binding protein
- length: 242
- theoretical pI: 5.91869
- theoretical MW: 27518.7
- GRAVY: -0.0921488
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 175.6)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 161.2)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 153.8)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 148.7)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 144.4)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 144.4)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 141.1)and 75 moreTransport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 128.5)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 125.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 125.2)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 123.4)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 123.4)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 118.1)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 116.6)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 115.8)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 115.7)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 112.4)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 112.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 109)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 108)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 107.8)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 106)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 105.6)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 105)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 104.3)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 97.1)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 92.1)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 91.8)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.9)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 90.9)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 90.6)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 89.4)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 88)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 88)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 86.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 84.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 84.3)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 84.3)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 83.6)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 83.6)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 82.8)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 81.4)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 79.4)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 77.8)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 77.8)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 77.8)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 76.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 76.3)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 75.9)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 75.7)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 75.7)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 74.4)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 71.2)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 69.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 69.8)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 69.7)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 66.5)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 62.6)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 61.1)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 61.1)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 60.6)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 58.7)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 55)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 53.9)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 51.5)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 51.5)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 51)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 46)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 44.1)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 38.5)Protein fate Degradation of proteins, peptides, and glycopeptides endopeptidase La (TIGR00763; EC 3.4.21.53; HMM-score: 19)DNA repair and recombination protein RadB (TIGR02237; HMM-score: 19)DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 17.7)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 15.4)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 14)DNA metabolism DNA replication, recombination, and repair Holliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 13.9)Cellular processes Chemotaxis and motility flagellar protein export ATPase FliI (TIGR03496; EC 3.6.3.14; HMM-score: 13.2)Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 12.8)Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions dTMP kinase (TIGR00041; EC 2.7.4.9; HMM-score: 12.5)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.2)flagellar protein export ATPase FliI (TIGR03498; EC 3.6.3.14; HMM-score: 11.9)arsenical pump-driving ATPase (TIGR04291; EC 3.6.1.-; HMM-score: 11.7)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 94.8)and 22 moreRsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 23.9)AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.2)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 19.4)AAA_23; AAA domain (PF13476; HMM-score: 17.3)AAA_30; AAA domain (PF13604; HMM-score: 16.8)AAA_22; AAA domain (PF13401; HMM-score: 16.6)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.7)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 15.1)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 14.6)Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 13.8)NTPase_1; NTPase (PF03266; HMM-score: 13.7)AAA_14; AAA domain (PF13173; HMM-score: 13.6)AAA_18; AAA domain (PF13238; HMM-score: 13.5)NB-ARC; NB-ARC domain (PF00931; HMM-score: 13.2)RuvB_N; Holliday junction DNA helicase RuvB P-loop domain (PF05496; HMM-score: 12.9)AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 12.8)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 12.7)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 12.4)PhoH; PhoH-like protein (PF02562; HMM-score: 12.4)bpMoxR; MoxR domain in the MoxR-vWA-beta-propeller ternary systems (PF20030; HMM-score: 12.1)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 11.9)no clan defined EAV_GS; Equine arteritis virus small envelope glycoprotein (PF01309; HMM-score: 11.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002744
- TAT(Tat/SPI): 0.000458
- LIPO(Sec/SPII): 0.000323
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000136224 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTEIRLEHVSYAYGQERILEDINLQVTSGEVVSILGPSGVGKTTLFNLIAGILEVQSGRIVLDGEENPKGRVSYMLQKDLLLEHKTVLGNIILPLLIQKVDKAEAISRADKILATFQLTAVRDKYPHELSGGMRQRVALLRTYLFGHKLFLLDEAFSALDEMTKMELHAWYLEIHKQLQLTTLIITHSIEEALNLSDRIYILKNRPGQIVSEIKLDWSEDEDKEVQKIAYKRQILAELGLDK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for TIGR4
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_2024 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.