Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 04-FEB-2016
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae INV200
- locus tag: SPNINV200_01010 [new locus tag: SPNINV200_RS00555 ]
- pan locus tag?: PNEUPAN000760000
- symbol: SPNINV200_01010
- pan gene symbol?: scaC
- synonym:
- product: putative ABC transporter, ATP-binding protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNINV200_01010 [new locus tag: SPNINV200_RS00555 ]
- symbol: SPNINV200_01010
- product: putative ABC transporter, ATP-binding protein
- replicon: chromosome
- strand: +
- coordinates: 107474..108115
- length: 642
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: FQ312029 (107474..108115) NCBI
- BioCyc: see SPNINV200_RS00555
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_0108 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGATTGAGTTGAAAAATATTACCAAAACCATTGGGGGAAAAGTGATTTTGGATAACTTA
TCTCTCAGGATTGATCAGGGGGATTTGGTAGCTATTGTTGGTAAGAGTGGTAGTGGGAAG
TCGACCTTGTTAAATTTATTGGGTTTGATAGATGGTGATTATAGCGGACGGTATGAGATT
TTTGGTCAGACAAATCTAGCGGTTAATTCTGCTAAGTCGCAAACAATAATCCGTGAACAT
ATCTCTTATCTGTTTCAAAATTTTGCCCTGATTGATGATGAAACGGTCGAGTACAATCTC
ATGCTGGCGCTGAAATATGTGAAATTGCCTAAGAAAGACAAGCTCAAAAAGGTGGAAGAG
ATTTTAGAGAGAGTAGGTTTGTCAGCTACTTTGCATCAAAGGGTCTCCGAGTTGTCTGGG
GGCGAACAACAACGAATTGCAGTTGCTAGAGCCATCTTAAAACCCAGCCAGCTGATTTTA
GCCGATGAACCTACAGGTTCGCTGGATCCTGAAAATAGAGATTTGGTCTTGAAGTTTCTC
TTAGAGATGAATCGAGAAGGGAAAACAGTCATTATTGTGACCCACGATGCTTATGTAGCC
CAACAATGTCATCGTGTCATTGAATTGGGCGAGGGAAAATGA60
120
180
240
300
360
420
480
540
600
642
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNINV200_01010 [new locus tag: SPNINV200_RS00555 ]
- symbol: SPNINV200_01010
- description: putative ABC transporter, ATP-binding protein
- length: 213
- theoretical pI: 6.96278
- theoretical MW: 23626.2
- GRAVY: -0.0924883
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 294.6)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 294.6)and 82 moreCellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 187.6)Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 169.2)Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 163.8)ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 152)thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 133.2)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 130.3)Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 128.7)Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 126.4)Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 125.3)D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 123.3)Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 119.3)Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 118.8)thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 114)Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 113.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 112.9)2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 112.6)Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 112)Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 111.7)Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 111.7)ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 110.2)Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 106.3)Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 106)Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 105.6)Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.6)Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.6)Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 102.4)Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 102.4)Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 102.4)Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 102.1)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 101.8)Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 100.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 100.7)gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 100)Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 99.8)Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 99.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 98.8)Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 98.8)Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 96.4)Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 96.4)phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 96)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 94.5)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 93.2)Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 93.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 92.9)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 92.3)ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 91.7)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 91.4)Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 89.8)Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 89.4)proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 87.2)ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 86.5)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 84.5)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 84.5)Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 82.8)Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.1)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 82.1)lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 82)Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 73.1)Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 71.8)Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 69.8)Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 69.8)Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 59.6)Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 58.6)DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 54.5)Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 53.5)Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 46.2)Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 46.1)Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 44.3)Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 38.1)Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 19.5)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 19.5)DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 18)restriction system-associated AAA family ATPase (TIGR04435; HMM-score: 15.4)Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 15.3)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 14.1)Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 13.9)Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 13.7)Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 13.7)Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 13.7)Biosynthesis of cofactors, prosthetic groups, and carriers Pantothenate and coenzyme A dephospho-CoA kinase (TIGR00152; EC 2.7.1.24; HMM-score: 13.2)type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 13.2)Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism dUTP diphosphatase (TIGR00576; EC 3.6.1.23; HMM-score: 13.1)
- TheSEED :
- ABC-type antimicrobial peptide transport system, ATPase component
- PFAM: P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 106)and 23 moreAAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 46.7)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 34.3)AAA_15; AAA ATPase domain (PF13175; HMM-score: 24.9)AAA_23; AAA domain (PF13476; HMM-score: 23.1)AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 22)Pox_A32; Poxvirus A32 protein (PF04665; HMM-score: 21.4)AAA_16; AAA ATPase domain (PF13191; HMM-score: 20.6)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 19.3)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 17.8)AAA_22; AAA domain (PF13401; HMM-score: 17.3)AAA_33; AAA domain (PF13671; HMM-score: 15.8)SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 15.4)ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 14.4)AAA_30; AAA domain (PF13604; HMM-score: 14.3)NB-ARC; NB-ARC domain (PF00931; HMM-score: 14.1)NACHT; NACHT domain (PF05729; HMM-score: 13.9)AAA_18; AAA domain (PF13238; HMM-score: 13.6)DUF87; Helicase HerA, central domain (PF01935; HMM-score: 13.4)DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 12.6)Dynamin_N; Dynamin family (PF00350; HMM-score: 12.2)AAA_25; AAA domain (PF13481; HMM-score: 12.2)FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 11.1)DUF6079; Family of unknown function (DUF6079) (PF19557; HMM-score: 9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.04
- Cytoplasmic Membrane Score: 9.96
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.2253
- Cytoplasmic Membrane Score: 0.7483
- Cell wall & surface Score: 0.001
- Extracellular Score: 0.0253
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006563
- TAT(Tat/SPI): 0.000346
- LIPO(Sec/SPII): 0.000465
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: CBW33735 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIELKNITKTIGGKVILDNLSLRIDQGDLVAIVGKSGSGKSTLLNLLGLIDGDYSGRYEIFGQTNLAVNSAKSQTIIREHISYLFQNFALIDDETVEYNLMLALKYVKLPKKDKLKKVEEILERVGLSATLHQRVSELSGGEQQRIAVARAILKPSQLILADEPTGSLDPENRDLVLKFLLEMNREGKTVIIVTHDAYVAQQCHRVIELGEGK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0108 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]