Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NU83127
- locus tag: SPNU_0669 [new locus tag: EL277_RS12225 ]
- pan locus tag?: PNEUPAN001668000
- symbol: SPNU_0669
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNU_0669 [new locus tag: EL277_RS12225 ]
- symbol: SPNU_0669
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 680967..681209
- length: 243
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AP018936 (680967..681209) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAACTATTCAAACCACTCTTAACTGTTTTAGCACTTGCCTTTGCCCTTATCTTTATC
ACTGCTTGTAGCTCAGGTGGAAACGCTGGTTCATCCTCTGGAAAAACAACTGCCAAAGCT
CGCACTATCGATGAAATCAAAAAAAGCGGTGAACTGCGAATCGCCGTGTTTGGAGATAAA
AAACCGTTTGGCTACGTTGACAATGATGGTTCTTACCAAGGCTACGCTACGATATTGAAC
TAG60
120
180
240
243
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNU_0669 [new locus tag: EL277_RS12225 ]
- symbol: SPNU_0669
- description: hypothetical protein
- length: 80
- theoretical pI: 9.907
- theoretical MW: 8449.71
- GRAVY: 0.11125
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Amino acids, peptides and amines ectoine/hydroxyectoine ABC transporter solute-binding protein EhuB (TIGR02995; HMM-score: 22.3)
- TheSEED:
- PFAM: PBP (CL0177) SBP_bac_3; Bacterial extracellular solute-binding proteins, family 3 (PF00497; HMM-score: 13.3)no clan defined ODV-E18; Occlusion-derived virus envelope protein ODV-E18 (PF10717; HMM-score: 13.1)DUF4969; Domain of unknown function (DUF4969) (PF16339; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- SignalP: Signal peptide LIPO(Sec/SPII) length 22 aa
- SP(Sec/SPI): 0.002622
- TAT(Tat/SPI): 0.000282
- LIPO(Sec/SPII): 0.99692
- Cleavage Site: CS pos: 22-23. ITA-CS. Pr: 0.9972
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBG34560 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKLFKPLLTVLALAFALIFITACSSGGNAGSSSGKTTAKARTIDEIKKSGELRIAVFGDKKPFGYVDNDGSYQGYATILN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.