Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 25-OCT-2019
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae NU83127
- locus tag: SPNU_1452 [new locus tag: EL277_RS07640 ]
- pan locus tag?: PNEUPAN002821000
- symbol: yugI
- pan gene symbol?: cvfD
- synonym:
- product: General stress protein 13
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPNU_1452 [new locus tag: EL277_RS07640 ]
- symbol: yugI
- product: General stress protein 13
- replicon: chromosome
- strand: -
- coordinates: 1443271..1443630
- length: 360
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AP018936 (1443271..1443630) NCBI
- BioCyc: see EL277_RS07640
- MicrobesOnline:
- PneumoBrowse for strain D39V: SPV_1366 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGAAAATCGGTGATAAGCTAAAGGGGCGTATTACAGGGATTCAGCCCTACGGTGCCTTT
GTTGAGTTAGAGACGGGTGATACGGGGCTGATTCACATTTCAGAGATTCGGACAGGATTT
ATTGAAAATATTCATGAAACCTTGAAAGTCGATGAAGAGGTTCAAGTTCAGGTAGTGGAT
TTAGATGAATTTACAGGGAAAGCCAGTCTTTCTATCCGCACTTTGGAGGAAGAAAAGTAC
CAGTTTCCTAGACGGAGACGCTTTTCAAGCGACCGCTTTAACTACGGCTTTGCTCCCTTT
CGACGAATGCTACCAATCTGGACTGGAGAAGCCCTGCACCATTTAAAAAAGAAGAAGTAG60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPNU_1452 [new locus tag: EL277_RS07640 ]
- symbol: YugI
- description: General stress protein 13
- length: 119
- theoretical pI: 9.51082
- theoretical MW: 13851.8
- GRAVY: -0.537815
⊟Function[edit | edit source]
- TIGRFAM: Transcription Degradation of RNA polyribonucleotide nucleotidyltransferase (TIGR03591; EC 2.7.7.8; HMM-score: 55.3)Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bS1 (TIGR00717; HMM-score: 51)and 4 moreguanosine pentaphosphate synthetase I/polyribonucleotide nucleotidyltransferase (TIGR02696; EC 2.7.-.-,2.7.7.8; HMM-score: 31.9)Transcription Degradation of RNA ribonuclease R (TIGR02063; EC 3.1.-.-; HMM-score: 26.6)Transcription Degradation of RNA ribonuclease, Rne/Rng family (TIGR00757; EC 3.1.4.-; HMM-score: 14.3)Transcription Degradation of RNA VacB and RNase II family 3'-5' exoribonucleases (TIGR00358; EC 3.1.13.1; HMM-score: 12.1)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: OB (CL0021) S1; S1 RNA binding domain (PF00575; HMM-score: 61.6)and 1 moreS1_2; S1 domain (PF13509; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9813
- Cytoplasmic Membrane Score: 0.0183
- Cell wall & surface Score: 0
- Extracellular Score: 0.0003
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002553
- TAT(Tat/SPI): 0.000111
- LIPO(Sec/SPII): 0.000337
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: BBG35335 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MKIGDKLKGRITGIQPYGAFVELETGDTGLIHISEIRTGFIENIHETLKVDEEVQVQVVDLDEFTGKASLSIRTLEEEKYQFPRRRRFSSDRFNYGFAPFRRMLPIWTGEALHHLKKKK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1366 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]