Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 22-NOV-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae P1031
- locus tag: SPP_RS03905 [old locus tag: SPP_0801 ]
- pan locus tag?: PNEUPAN001742000
- symbol: SPP_RS03905
- pan gene symbol?: metG_1
- synonym:
- product: DUF2829 domain-containing protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPP_RS03905 [old locus tag: SPP_0801 ]
- symbol: SPP_RS03905
- product: DUF2829 domain-containing protein
- replicon: chromosome
- strand: +
- coordinates: 728995..729231
- length: 237
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_012467 (728995..729231) NCBI
- BioCyc: SPP_RS03905 BioCyc
- MicrobesOnline: see SPP_0801
- PneumoBrowse for strain D39V: SPV_0694 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACATTTGAAGAAATTCTACCTGGCTTAAAGGCTAAGAAAAAATATGTACGAACTGGT
TGGGGAGGTGCTGAAAACTATGTCCAACTCTTTGATACCATCGAGCAAAATGGGCTTGCA
CTTGAAGTGACACCTTATTTCTTAATCAACGTGTCTGGAGAAGGAGAAGGTTTTTCCATG
TGGAGCCCGACAGCTTGTGATGTTTTGGCAACGGATTGGGTAGAAGTGCATGACTAA60
120
180
237
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPP_RS03905 [old locus tag: SPP_0801 ]
- symbol: SPP_RS03905
- description: DUF2829 domain-containing protein
- length: 78
- theoretical pI: 4.07008
- theoretical MW: 8714.78
- GRAVY: -0.102564
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SPP_0801
- PFAM: no clan defined DUF2829; Protein of unknown function (DUF2829) (PF11195; HMM-score: 77.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9116
- Cytoplasmic Membrane Score: 0.0185
- Cell wall & surface Score: 0.0012
- Extracellular Score: 0.0688
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010404
- TAT(Tat/SPI): 0.000281
- LIPO(Sec/SPII): 0.000603
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000141910 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MTFEEILPGLKAKKKYVRTGWGGAENYVQLFDTIEQNGLALEVTPYFLINVSGEGEGFSMWSPTACDVLATDWVEVHD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0694 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]