Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 17-DEC-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae Taiwan19F-14
- locus tag: SPT_RS02925 [old locus tag: SPT_0587 ]
- pan locus tag?: PNEUPAN001435000
- symbol: rbfA
- pan gene symbol?: rbfA
- synonym:
- product: 30S ribosome-binding factor RbfA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPT_RS02925 [old locus tag: SPT_0587 ]
- symbol: rbfA
- product: 30S ribosome-binding factor RbfA
- replicon: chromosome
- strand: +
- coordinates: 549821..550171
- length: 351
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_012469 (549821..550171) NCBI
- BioCyc: SPT_RS02925 BioCyc
- MicrobesOnline: see SPT_0587
- PneumoBrowse for strain D39V: SPV_0483 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGGCAAATCATTTCCGTACAGATCGTGTGGGCATGGAAATCAAGCGTGAAGTCAATGAG
ATTTTGCAAAAGAAAGTCCGTGATCCACGTGTCCAAGGTGTGACCATCACAGATGTTCAG
ATGCTGGGTGACTTGTCTGTTGCCAAGGTTTATTACACCATTTTGAGTAACCTTGCTTCG
GATAACCAAAAAGCCCAAATCGGGCTTGAAAAAGCAACTGGTACCATCAAACGTGAACTT
GGTCGCAATTTGAAATTGTACAAAATCCCAGATTTGACCTTCGTCAAAGACGAGTCCATC
GAGTATGGAAACAAGATTGACGAGATGCTACGCAATCTGGATAAGAACTAA60
120
180
240
300
351
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPT_RS02925 [old locus tag: SPT_0587 ]
- symbol: RbfA
- description: 30S ribosome-binding factor RbfA
- length: 116
- theoretical pI: 9.70993
- theoretical MW: 13310.3
- GRAVY: -0.553448
⊟Function[edit | edit source]
- TIGRFAM: Transcription RNA processing ribosome-binding factor A (TIGR00082; HMM-score: 107.9)
- TheSEED: see SPT_0587
- PFAM: DnaA_N (CL0494) RBFA; Ribosome-binding factor A (PF02033; HMM-score: 110.6)and 1 moreno clan defined Glyco_trans_A_1; Glycosyl transferase 1 domain A (PF09318; HMM-score: 13.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9916
- Cytoplasmic Membrane Score: 0.0003
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.008
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002881
- TAT(Tat/SPI): 0.000504
- LIPO(Sec/SPII): 0.000427
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANHFRTDRVGMEIKREVNEILQKKVRDPRVQGVTITDVQMLGDLSVAKVYYTILSNLASDNQKAQIGLEKATGTIKRELGRNLKLYKIPDLTFVKDESIEYGNKIDEMLRNLDKN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: rimP > nusA > rnpM > SPT_RS02915 > infB > rbfA
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0483 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]