From PneumoWiki
Jump to navigation Jump to search
PangenomeTIGR4
serotype 4
D39
serotype 2
D39V
serotype 2
Hungary19A-6
serotype 19A
EF3030
serotype 19F
670-6B
serotype 6B
6A-10
serotype 6A
70585
serotype 5
A026
serotype 19F
A66
serotype 3
AP200
serotype 11A
ASP0581
serotype 12F
ATCC 49619
serotype 19F
ATCC 700669
serotype 23F
BM6001
serotype 19F
BVJ1JL
serotype 1
CGSP14
serotype 14
G54
serotype 19F
HU-OH
serotype 3
Hu15
serotype 19A
Hu17
serotype 19A
INV104
serotype 1
INV200
serotype 14
JJA
serotype 14
MDRSPN001
serotype 19F
NCTC7465
serotype 1
NCTC7466
serotype 2
NU83127
serotype 4
OXC141
serotype 3
P1031
serotype 1
R6
serotype 2
SP49
serotype 19A
SPN032672
serotype 1
SPN034156
serotype 3
SPN034183
serotype 3
SPN994038
serotype 3
SPN994039
serotype 3
SPNA45
serotype 3
ST556
serotype 19F
TCH8431/19A
serotype 19A
Taiwan19F-14
serotype 19F
Xen35
serotype 4
gamPNI0373
serotype 1

NCBI: 17-DEC-2024

⊟Summary[edit | edit source]

  • organism: Streptococcus pneumoniae Taiwan19F-14
  • locus tag: SPT_RS04875 [old locus tag: SPT_0987 ]
  • pan locus tag?: PNEUPAN002491000
  • symbol: SPT_RS04875
  • pan gene symbol?: glnQ5
  • synonym:
  • product: amino acid ABC transporter ATP-binding protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SPT_RS04875 [old locus tag: SPT_0987 ]
  • symbol: SPT_RS04875
  • product: amino acid ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 931998..932738
  • length: 741
  • essential: unknown

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGGCAAAATTAAAAATTGATGTAAATGATTTACACAAGCACTATGGAAAAAATGAAGTC
    CTAAAAGGAATTACGACTAAGTTCTATGAAGGAGATGTTGTTTGTATCATCGGTCCTTCA
    GGTTCTGGTAAGTCAACTTTCCTCCGTAGCCTCAATCTTTTAGAAGAAGTCACTAGCGGT
    CACATCACTGTGAACGGCTATGATTTAACTGAAAAAACAACCAATGTTGACCACGTCCGT
    GAAAATATCGGCATGGTATTCCAACACTTCAACCTCTTCCCTCATATGTCTGTATTGGAC
    AACATCACCTTTGCTCCTATTGAGCACAAGTTGATGACTAAGGAAGAAGCTGAGGAATTG
    GGAATGGAGTTGCTTGAAAAGGTTGGACTAGCAGATAAAGCTAATGCCAATCCAGATAGC
    CTATCAGGTGGTCAAAAACAACGTGTGGCCATCGCTCGTGGCCTAGCAATGAATCCAGAC
    ATCATGCTCTTCGATGAACCAACTTCTGCCCTTGACCCTGAGATGGTTGGAGACGTACTT
    AACGTTATGAAGGAATTGGCTGAGCAAGGCATGACCATGATTATCGTAACCCATGAGATG
    GGATTTGCTCGTCAGGTTGCCAACCGCGTTATCTTTACTGCAGATGGCGAGTTCCTTGAA
    GACGGAACACCTGACCAAATCTTTGATAACCCACAACACCCTCGTCTGAAAGAGTTCTTA
    GATAAGGTCTTAAACGTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SPT_RS04875 [old locus tag: SPT_0987 ]
  • symbol: SPT_RS04875
  • description: amino acid ABC transporter ATP-binding protein
  • length: 246
  • theoretical pI: 4.73788
  • theoretical MW: 27352.1
  • GRAVY: -0.210569

⊟Function[edit | edit source]

  • TIGRFAM:
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 299.2)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 264.6)
    and 82 more
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 207.9)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 201.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 197.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 195)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 192.7)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 188.9)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 187.2)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 179.9)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 177)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 172.3)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 172.3)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 172.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 165.6)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 162.1)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 153.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 152.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 149.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 144)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 144)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 140.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 140.3)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 140.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 133.8)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 132.8)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 130.8)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 130.1)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 129.6)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 129.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 129.4)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 129.2)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 122.4)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 122.4)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 121.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 120.2)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 119.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 119)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 118.8)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 117.2)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 116.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 116.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 115.5)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 115.5)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 113.9)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 112.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 106.3)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 106)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 106)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 104.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 104.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 101.6)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 101.6)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 99.2)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 99.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 98.6)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 98.6)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 98.6)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 91.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 91.2)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 84.5)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 84)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 83.8)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 83.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 61)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 61)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 58)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 51.9)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 49.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 45.8)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 38.2)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 14.6)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 14.6)
    rad50 (TIGR00606; HMM-score: 13.6)
    Cell structure Cell envelope Surface structures twitching motility protein (TIGR01420; HMM-score: 13.6)
    Cellular processes Cellular processes Chemotaxis and motility twitching motility protein (TIGR01420; HMM-score: 13.6)
    P-type DNA transfer ATPase VirB11 (TIGR02788; HMM-score: 13.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.9)
    type IV secretion/conjugal transfer ATPase, VirB4 family (TIGR00929; HMM-score: 12.6)
    KaiC domain protein, AF_0351 family (TIGR03880; HMM-score: 12)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 11.2)
    Cellular processes Cellular processes Pathogenesis type II secretion system protein E (TIGR02533; HMM-score: 11)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type II secretion system protein E (TIGR02533; HMM-score: 11)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair exonuclease SbcC (TIGR00618; HMM-score: 10.8)
  • TheSEED: see SPT_0987
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 120.1)
    and 37 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 43.1)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 41)
    AAA_22; AAA domain (PF13401; HMM-score: 21.6)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 20.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 20.5)
    AAA_33; AAA domain (PF13671; HMM-score: 19)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 18.9)
    AAA_23; AAA domain (PF13476; HMM-score: 18.7)
    AAA_13; AAA domain (PF13166; HMM-score: 18.3)
    ABC_ATPase; ATPase of the ABC class (PF09818; HMM-score: 17.2)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.1)
    AAA_18; AAA domain (PF13238; HMM-score: 16.9)
    AAA_30; AAA domain (PF13604; HMM-score: 16.5)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.4)
    NACHT; NACHT domain (PF05729; HMM-score: 16.2)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 16.1)
    AAA_24; AAA domain (PF13479; HMM-score: 15.6)
    SbcC_Walker_B; SbcC/RAD50-like, Walker B motif (PF13558; HMM-score: 14.2)
    AAA_28; AAA domain (PF13521; HMM-score: 14.1)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 13.8)
    G-alpha; G-protein alpha subunit (PF00503; HMM-score: 13.7)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 13.5)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 13.4)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 13.3)
    Pox_A32; Poxvirus A32 protein (PF04665; HMM-score: 13.1)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 12.9)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 12.8)
    Septin; Septin (PF00735; HMM-score: 12.7)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 12.6)
    AAA_14; AAA domain (PF13173; HMM-score: 12.6)
    ATPase; KaiC (PF06745; HMM-score: 12.4)
    DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 12.1)
    FtsK_SpoIIIE; FtsK/SpoIIIE family (PF01580; HMM-score: 12.1)
    AAA_25; AAA domain (PF13481; HMM-score: 12.1)
    DO-GTPase2; Double-GTPase 2 (PF19993; HMM-score: 12.1)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11.8)
    CobU; Cobinamide kinase / cobinamide phosphate guanyltransferase (PF02283; HMM-score: 11.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.1791
    • Cytoplasmic Membrane Score: 0.7673
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0534
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011061
    • TAT(Tat/SPI): 0.00016
    • LIPO(Sec/SPII): 0.000379
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

  • GI:
  • RefSeq: WP_001096313 NCBI
  • UniProt:

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAKLKIDVNDLHKHYGKNEVLKGITTKFYEGDVVCIIGPSGSGKSTFLRSLNLLEEVTSGHITVNGYDLTEKTTNVDHVRENIGMVFQHFNLFPHMSVLDNITFAPIEHKLMTKEEAEELGMELLEKVGLADKANANPDSLSGGQKQRVAIARGLAMNPDIMLFDEPTSALDPEMVGDVLNVMKELAEQGMTMIIVTHEMGFARQVANRVIFTADGEFLEDGTPDQIFDNPQHPRLKEFLDKVLNV

⊟Experimental data[edit | edit source]

  • protein localization:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription[edit | edit source]

  • transcription start site:

⊟Expression data[edit | edit source]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟'lacZ' fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]