Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae D39V
- locus tag: SPV_RS01125 [old locus tag: SPV_0204 ]
- pan locus tag?: PNEUPAN000949000
- symbol: rplX
- pan gene symbol?: rplX
- synonym:
- product: 50S ribosomal protein L24
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPV_RS01125 [old locus tag: SPV_0204 ]
- symbol: rplX
- product: 50S ribosomal protein L24
- replicon: chromosome
- strand: +
- coordinates: 201750..202055
- length: 306
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP027540 (201750..202055) NCBI
- BioCyc: see SPV_0204
- MicrobesOnline:
- PneumoBrowse: SPV_0204 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTGTAAAAAAAGGCGACAAAGTTCGCGTAATCGCTGGTAAAGATAAGGGAACAGAA
GCTGTTGTCCTTACTGCCCTTCCAAAAGTAAACAAAGTTATCGTTGAAGGTGTTAACATT
GTTAAGAAACACCAACGTCCAACTAACGAGCTTCCTCAAGGTGGTATCATCGAGAAAGAA
GCAGCTATCCACGTATCAAACGTTCAAGTTTTGGACAAAAATGGTGTAGCTGGTCGTGTT
GGTTACAAATTTGTAGACGGTAAAAAAGTTCGCTACAACAAAAAATCAGGCGAAGTGCTT
GATTAA60
120
180
240
300
306
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPV_RS01125 [old locus tag: SPV_0204 ]
- symbol: RplX
- description: 50S ribosomal protein L24
- length: 101
- theoretical pI: 10.6257
- theoretical MW: 10990.8
- GRAVY: -0.320792
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01079; HMM-score: 117.7)and 3 moreProtein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uL24 (TIGR01080; HMM-score: 20.1)Hypothetical proteins Conserved conserved hypothetical protein (TIGR03833; HMM-score: 13.2)Transcription Transcription factors transcription elongation factor/antiterminator RfaH (TIGR01955; HMM-score: 12.7)
- TheSEED: data available for D39, Hungary19A-6, TIGR4
- PFAM: no clan defined ribosomal_L24; Ribosomal proteins 50S L24/mitochondrial 39S L24 (PF17136; HMM-score: 90.6)and 3 moreKOW (CL0107) KOW; KOW motif (PF00467; HMM-score: 28.2)no clan defined YjhX_toxin; Putative toxin of bacterial toxin-antitoxin pair (PF09857; HMM-score: 12.3)DUF2196; Uncharacterized conserved protein (DUF2196) (PF09962; HMM-score: 10.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6817
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.3182
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004393
- TAT(Tat/SPI): 0.000207
- LIPO(Sec/SPII): 0.001378
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_000497691 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MFVKKGDKVRVIAGKDKGTEAVVLTALPKVNKVIVEGVNIVKKHQRPTNELPQGGIIEKEAAIHVSNVQVLDKNGVAGRVGYKFVDGKKVRYNKKSGEVLD
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Expression data[edit | edit source]
- PneumoExpress: SPV_0204 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]