Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 08-SEP-2024
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae D39V
- locus tag: SPV_RS11535
- pan locus tag?: PNEUPAN001467000
- symbol: SPV_RS11535
- pan gene symbol?: —
- synonym:
- product: DEAD/DEAH box helicase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SPV_RS11535
- symbol: SPV_RS11535
- product: DEAD/DEAH box helicase
- replicon: chromosome
- strand: +
- coordinates: 507449..507652
- length: 204
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NZ_CP027540 (507449..507652) NCBI
- BioCyc:
- MicrobesOnline:
- PneumoBrowse:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATTCAATCTCTATTTAAGTTGGAAAATAGTCAAAGTCTTTTGGATGAGTATGAGATG
ATGATTGTGGATGAGTGTCATCATATCTCTGCCTTGATGTTTGAAAAAGTTGTTGCTCAG
TTTAGAGGGAAGTATCTTTACGGTTTGACGGCTACGCCTGAGCGTAAGAATGGTCATGAA
CCTATTGTTTTTCAGAGAAATTGA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SPV_RS11535
- symbol: SPV_RS11535
- description: DEAD/DEAH box helicase
- length: 67
- theoretical pI: 6.2328
- theoretical MW: 7876.05
- GRAVY: -0.291045
⊟Function[edit | edit source]
- reaction: EC 3.6.4.-? ExPASy
- TIGRFAM: DNA metabolism DNA replication, recombination, and repair DNA repair helicase rad25 (TIGR00603; EC 3.6.4.12; HMM-score: 20.8)and 1 moreDNA phosphorothioation system restriction enzyme (TIGR04095; HMM-score: 16.4)
- TheSEED:
- PFAM: P-loop_NTPase (CL0023) ResIII; Type III restriction enzyme, res subunit (PF04851; HMM-score: 37.1)and 2 moreFerritin (CL0044) AurF; P-aminobenzoate N-oxygenase AurF (PF11583; HMM-score: 15.7)P-loop_NTPase (CL0023) DEAD; DEAD/DEAH box helicase (PF00270; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.955
- Cytoplasmic Membrane Score: 0.0223
- Cell wall & surface Score: 0.0007
- Extracellular Score: 0.022
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001776
- TAT(Tat/SPI): 0.000266
- LIPO(Sec/SPII): 0.000264
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: WP_001812480 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MIQSLFKLENSQSLLDEYEMMIVDECHHISALMFEKVVAQFRGKYLYGLTATPERKNGHEPIVFQRN
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]