Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_0345
- pan locus tag?:
- symbol: SP_0345
- pan gene symbol?: —
- synonym:
- product: IS630-Spn1, transposase Orf1
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_0345
- symbol: SP_0345
- product: IS630-Spn1, transposase Orf1
- replicon: chromosome
- strand: -
- coordinates: 319495..319842
- length: 348
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (319495..319842) NCBI
- BioCyc:
- MicrobesOnline: 2149466 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTGGTATAATCTTCTTATGGCATATTCAATAGATTTTCGTAAAAAAGTTCTCTCTTAT
TGTGAGCGAACAGGTAGTATAACAGAAGCATCACACGTTTTCCAAATATCACGTAATACC
ATTTATGGCTGGTTAAAGCTAAAAGAGAAAACAGGAGAGCTAAACCACCAAGTAAAAGGA
ACAAAACCAAGAAAAGTTGATAGAGATAGACTTAAAAACTATCTTACTGACAATCCAGAC
GCTTATTTGACTGAAATAGCTTCTGAATTTGGCTGTCATCCAACTACCATCCACTATGCG
CTCAAAGCTATGGGCTACACTCGAAAAAAAGAACCACACCTACTATGA60
120
180
240
300
348
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_0345
- symbol: SP_0345
- description: IS630-Spn1, transposase Orf1
- length: 115
- theoretical pI: 9.85493
- theoretical MW: 13484.5
- GRAVY: -0.646087
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General DNA binding domain, excisionase family (TIGR01764; HMM-score: 13.2)
- TheSEED :
- Mobile element protein
- PFAM: HTH (CL0123) HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 99.9)and 19 moreHTH_28; Helix-turn-helix domain (PF13518; HMM-score: 42)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 27.7)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 27.6)HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 24.9)HTH_30; PucR C-terminal helix-turn-helix domain (PF13556; HMM-score: 21.3)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 19.7)CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 17.8)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 17)Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 16.3)HTH_8; Bacterial regulatory protein, Fis family (PF02954; HMM-score: 16.1)FeoC; FeoC like transcriptional regulator (PF09012; HMM-score: 15.8)HTH_Tnp_1_2; Helix-turn-helix of insertion element transposase (PF13022; HMM-score: 15.1)HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 13.3)HTH_PafC; PafC helix-turn-helix domain (PF19187; HMM-score: 13.1)no clan defined YrzK; Uncharacterized YrzK-like (PF17449; HMM-score: 12.8)DUF658; Protein of unknown function (DUF658) (PF04936; HMM-score: 12.7)HTH (CL0123) UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 12.4)HTH_22; HTH domain (PF13309; HMM-score: 12.4)HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9694
- Cytoplasmic Membrane Score: 0.0012
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0292
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011372
- TAT(Tat/SPI): 0.000462
- LIPO(Sec/SPII): 0.004648
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MWYNLLMAYSIDFRKKVLSYCERTGSITEASHVFQISRNTIYGWLKLKEKTGELNHQVKGTKPRKVDRDRLKNYLTDNPDAYLTEIASEFGCHPTTIHYALKAMGYTRKKEPHLL
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]