Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_1053 [new locus tag: SP_RS13400 ]
- pan locus tag?: PNEUPAN002115000
- symbol: SP_1053
- pan gene symbol?: —
- synonym:
- product: conserved domain protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_1053 [new locus tag: SP_RS13400 ]
- symbol: SP_1053
- product: conserved domain protein
- replicon: chromosome
- strand: +
- coordinates: 990096..990473
- length: 378
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (990096..990473) NCBI
- BioCyc:
- MicrobesOnline: 116526 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361TTGGGACAAAAAGTTGTAGCCATGCTTGATTTTTTATTAGCATATAGTGATTATTCTAAA
GACTTCAGACCATTGATTATTGATCAGCCTGAAGACAATCTAGACAATCGTTATATTTAC
AGGCATTTAGTTCAGCAGTTTAGAGATGTGAAAGCTCAACGTCAAATTATTTTAGCAACA
CATAATGCTACAATTGTAACAAATTCTATGACAGATCAAGTTGTTATTATGGAGTCAGAT
GGAGTTAACGGATGGATTGAATCACAGGGATATGTTAGTGAAAAATATATAAAAAATCAT
ATCATCAATCAATTAGAGGGAGGAAAAGATTCCTTCAAGCATAAAATGTCTATATATGAG
ACGGCTTTATCAGAGTAG60
120
180
240
300
360
378
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_1053 [new locus tag: SP_RS13400 ]
- symbol: SP_1053
- description: conserved domain protein
- length: 125
- theoretical pI: 5.58474
- theoretical MW: 14473.3
- GRAVY: -0.4064
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 16.2)Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 16.2)Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 16.1)Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 15.4)Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 13.2)Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 13.2)
- TheSEED :
- conserved domain protein
- PFAM: P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 20.9)SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 19.1)and 1 moreno clan defined YmgB; Biofilm development protein YmgB/AriR (PF10798; HMM-score: 13.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5466
- Cytoplasmic Membrane Score: 0.2945
- Cell wall & surface Score: 0.0022
- Extracellular Score: 0.1567
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.015396
- TAT(Tat/SPI): 0.000179
- LIPO(Sec/SPII): 0.004987
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MGQKVVAMLDFLLAYSDYSKDFRPLIIDQPEDNLDNRYIYRHLVQQFRDVKAQRQIILATHNATIVTNSMTDQVVIMESDGVNGWIESQGYVSEKYIKNHIINQLEGGKDSFKHKMSIYETALSE
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_1050 > SP_1051 > SP_1052 > SP_1053
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)