Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_1218 [new locus tag: SP_RS05970 ]
- pan locus tag?: PNEUPAN002456000
- symbol: SP_1218
- pan gene symbol?: srtA
- synonym:
- product: conserved hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_1218 [new locus tag: SP_RS05970 ]
- symbol: SP_1218
- product: conserved hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1146647..1147018
- length: 372
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (1146647..1147018) NCBI
- BioCyc:
- MicrobesOnline: 116683 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1076 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAACGCGAGCAAGTAATGGGAGAAGGAAATTATAGTCTAGCTAGTCACCATATCTTT
GGTGTTGATAATGCTAATAAAATGTTATTTTCTCCTTTAGATAATGCTAAAAATGGCATG
AAGATTTATCTAACCGATAAAAATAAAGTTTATACTTATGAAATACGTGAAGTCAAACGT
GTGACACCGGATCGTGTTGATGAAGTTGATGATAGAGATGGGGTCAATGAAATCACATTA
GTAACCTGTGAAGACCTTGCTGCTACAGAACGTATTATTGTCAAAGGTGATTTGAAAGAA
ACAAAAGATTATTCACAAACATCTAATGAAATCCTAACAGCTTTCAATCAACCATATAAA
CAATTTTATTAA60
120
180
240
300
360
372
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_1218 [new locus tag: SP_RS05970 ]
- symbol: SP_1218
- description: conserved hypothetical protein
- length: 123
- theoretical pI: 4.97775
- theoretical MW: 14188.9
- GRAVY: -0.698374
⊟Function[edit | edit source]
- TIGRFAM: Cell envelope Other sortase (TIGR01076; EC 3.4.22.-; HMM-score: 54.4)Protein fate Protein and peptide secretion and trafficking sortase (TIGR01076; EC 3.4.22.-; HMM-score: 54.4)
- TheSEED :
- Sortase A, LPXTG specific
and 1 more - PFAM: no clan defined Sortase; Sortase domain (PF04203; HMM-score: 63.1)and 3 moreDKNYY; DKNYY family (PF13644; HMM-score: 15.7)Transthyretin (CL0287) FctA; Spy0128-like isopeptide containing domain (PF12892; HMM-score: 14.5)no clan defined HdcB; Histidine decarboxylase maturation protein HdcB (PF17528; HMM-score: 14.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.1051
- Cytoplasmic Membrane Score: 0.2071
- Cell wall & surface Score: 0.0016
- Extracellular Score: 0.6861
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004815
- TAT(Tat/SPI): 0.000401
- LIPO(Sec/SPII): 0.001196
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKREQVMGEGNYSLASHHIFGVDNANKMLFSPLDNAKNGMKIYLTDKNKVYTYEIREVKRVTPDRVDEVDDRDGVNEITLVTCEDLAATERIIVKGDLKETKDYSQTSNEILTAFNQPYKQFY
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1076 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
Arun S Kharat, Alexander Tomasz
Inactivation of the srtA gene affects localization of surface proteins and decreases adhesion of Streptococcus pneumoniae to human pharyngeal cells in vitro.
Infect Immun: 2003, 71(5);2758-65
[PubMed:12704150] [WorldCat.org] [DOI] (P p)