⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_1227 [new locus tag: SP_RS06015 ]
- pan locus tag?: PNEUPAN002466000
- symbol: SP_1227
- pan gene symbol?: vicR
- synonym: yycF
- product: DNA-binding response regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_1227 [new locus tag: SP_RS06015 ]
- symbol: SP_1227
- product: DNA-binding response regulator
- replicon: chromosome
- strand: -
- coordinates: 1159455..1160159
- length: 705
- essential: yes [1] DEG
⊟Accession numbers[edit | edit source]
- Location: AE005672 (1159455..1160159) NCBI
- BioCyc:
- MicrobesOnline: 116692 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1085 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGAAAAAAATACTAATTGTAGATGATGAGAAACCAATCTCGGATATTATCAAGTTTAAT
ATGACCAAGGAAGGTTACGAAGTTGTAACTGCTTTTAATGGTCGTGAAGCGCTAGAGCAA
TTTGAAGCAGAGCAACCAGATATTATTATTCTGGATTTGATGCTTCCAGAAATTGATGGT
TTAGAAGTTGCTAAGACCATTCGTAAGACAAGCAGTGTGCCCATTCTTATGCTTTCAGCC
AAAGATAGTGAATTTGATAAGGTTATCGGTTTGGAACTTGGGGCAGATGACTATGTAACA
AAACCCTTCTCCAATCGTGAGTTGCAGGCGCGTGTTAAAGCTCTTCTGCGTCGTTCTCAA
CCTATGCCAGTAGATGGTCAGGAAGCAGATAGTAAACCTCAACCTATCCAAATTGGGGAT
TTAGAAATTGTTCCAGACGCCTACGTGGCTAAAAAATATGGCGAAGAACTAGACTTAACC
CATCGTGAATTTGAGCTTTTGTATCATTTAGCATCGCATACAGGTCAAGTCATCACGCGC
GAACACTTGCTTGAGACTGTCTGGGGTTATGACTATTTTGGTGATGTCCGTACAGTTGAT
GTGACTGTACGACGTCTGCGTGAGAAGATTGAAGATACGCCCAGCCGACCAGAGTATATC
TTGACGCGCCGTGGTGTAGGGTATTACATGAGAAATAATGCTTGA60
120
180
240
300
360
420
480
540
600
660
705
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_1227 [new locus tag: SP_RS06015 ]
- symbol: SP_1227
- description: DNA-binding response regulator
- length: 234
- theoretical pI: 4.7165
- theoretical MW: 26815.4
- GRAVY: -0.396581
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 223.1)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 223.1)and 8 moreRegulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 177.7)proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 133)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 67.6)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 60.7)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 60.7)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 60.7)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 44.2)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 37.6)
- TheSEED :
- Two-component response regulator SA14-24
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 106.3)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 97)and 1 moreCheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 13.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9959
- Cytoplasmic Membrane Score: 0.0014
- Cell wall & surface Score: 0
- Extracellular Score: 0.0026
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002466
- TAT(Tat/SPI): 0.000078
- LIPO(Sec/SPII): 0.000232
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAEQPDIIILDLMLPEIDGLEVAKTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQPMPVDGQEADSKPQPIQIGDLEIVPDAYVAKKYGEELDLTHREFELLYHLASHTGQVITREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMRNNA
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site: 1160174 [2]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1085 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Jane A Thanassi, Sandra L Hartman-Neumann, Thomas J Dougherty, Brian A Dougherty, Michael J Pucci
Identification of 113 conserved essential genes using a high-throughput gene disruption system in Streptococcus pneumoniae.
Nucleic Acids Res: 2002, 30(14);3152-62
[PubMed:12136097] [WorldCat.org] [DOI] (I p)Tim van Opijnen, Andrew Camilli
A fine scale phenotype-genotype virulence map of a bacterial pathogen.
Genome Res: 2012, 22(12);2541-51
[PubMed:22826510] [WorldCat.org] [DOI] (I p) - ↑ 2.0 2.1 2.2 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)
⊟Relevant publications[edit | edit source]
J R Echenique, M C Trombe
Competence repression under oxygen limitation through the two-component MicAB signal-transducing system in Streptococcus pneumoniae and involvement of the PAS domain of MicB.
J Bacteriol: 2001, 183(15);4599-608
[PubMed:11443095] [WorldCat.org] [DOI] (P p)Aras Kadioglu, Josè Echenique, Sonia Manco, Marie-Claude Trombe, Peter W Andrew
The MicAB two-component signaling system is involved in virulence of Streptococcus pneumoniae.
Infect Immun: 2003, 71(11);6676-9
[PubMed:14573696] [WorldCat.org] [DOI] (P p)Wai-Leung Ng, Gregory T Robertson, Krystyna M Kazmierczak, Jingyong Zhao, Raymond Gilmour, Malcolm E Winkler
Constitutive expression of PcsB suppresses the requirement for the essential VicR (YycF) response regulator in Streptococcus pneumoniae R6.
Mol Microbiol: 2003, 50(5);1647-63
[PubMed:14651645] [WorldCat.org] [DOI] (P p)M Luz Mohedano, Karin Overweg, Alicia de la Fuente, Mark Reuter, Silvia Altabe, Francis Mulholland, Diego de Mendoza, Paloma López, Jerry M Wells
Evidence that the essential response regulator YycF in Streptococcus pneumoniae modulates expression of fatty acid biosynthesis genes and alters membrane composition.
J Bacteriol: 2005, 187(7);2357-67
[PubMed:15774879] [WorldCat.org] [DOI] (P p)Wai-Leung Ng, Ho-Ching Tiffany Tsui, Malcolm E Winkler
Regulation of the pspA virulence factor and essential pcsB murein biosynthetic genes by the phosphorylated VicR (YycF) response regulator in Streptococcus pneumoniae.
J Bacteriol: 2005, 187(21);7444-59
[PubMed:16237028] [WorldCat.org] [DOI] (P p)Skye M Barendt, Lok-To Sham, Malcolm E Winkler
Characterization of mutants deficient in the L,D-carboxypeptidase (DacB) and WalRK (VicRK) regulon, involved in peptidoglycan maturation of Streptococcus pneumoniae serotype 2 strain D39.
J Bacteriol: 2011, 193(9);2290-300
[PubMed:21378199] [WorldCat.org] [DOI] (I p)Maria L Mohedano, Mónica Amblar, Alicia de la Fuente, Jerry M Wells, Paloma López
The Response Regulator YycF Inhibits Expression of the Fatty Acid Biosynthesis Repressor FabT in Streptococcus pneumoniae.
Front Microbiol: 2016, 7;1326
[PubMed:27610104] [WorldCat.org] [DOI] (P e)