Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_1354 [new locus tag: SP_RS06625 ]
- pan locus tag?: PNEUPAN000358000
- symbol: rplL
- pan gene symbol?: rplL
- synonym:
- product: ribosomal protein L7/L12
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_1354 [new locus tag: SP_RS06625 ]
- symbol: rplL
- product: ribosomal protein L7/L12
- replicon: chromosome
- strand: -
- coordinates: 1274614..1274982
- length: 369
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (1274614..1274982) NCBI
- BioCyc:
- MicrobesOnline: 116811 MicrobesOnline
- PneumoBrowse for strain D39V: SPV_1187 PneumoBrowse
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGGCATTGAACATTGAAAACATTATTGCTGAAATTAAAGAAGCTTCAATCCTTGAATTG
AACGACCTTGTAAAAGCTATCGAAGAAGAATTTGGTGTAACTGCAGCTGCTCCTGTAGCT
GTTGCTGCAGCTGATGCAGCTGATGCTGGTGCTGCTAAAGATTCATTCGACGTTGAATTG
ACATCTGCAGGCGACAAAAAAGTTGGCGTTATCAAAGTTGTACGTGAAATCACTGGTCTT
GGTCTTAAAGAAGCTAAAGAACTTGTTGACGGTGCACCAGCACTTGTTAAAGAAGGCGTT
GCAACTGCAGAAGCTGAAGAAATCAAAGCTAAATTGGAAGAAGCTGGAGCTTCAGTTACT
CTTAAATAA60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_1354 [new locus tag: SP_RS06625 ]
- symbol: RplL
- description: ribosomal protein L7/L12
- length: 122
- theoretical pI: 4.13202
- theoretical MW: 12442.1
- GRAVY: 0.261475
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL12 (TIGR00855; HMM-score: 149.5)
- TheSEED :
- LSU ribosomal protein L7p/L12p (P1/P2)
- PFAM: no clan defined Ribosomal_L12; Ribosomal protein L7/L12 C-terminal domain (PF00542; HMM-score: 103.7)and 1 moreRibosomal_L12_N; Ribosomal protein L7/L12 dimerisation domain (PF16320; HMM-score: 68.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.8347
- Cytoplasmic Membrane Score: 0.0151
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.1498
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.018324
- TAT(Tat/SPI): 0.010926
- LIPO(Sec/SPII): 0.000753
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MALNIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAVAAADAADAGAAKDSFDVELTSAGDKKVGVIKVVREITGLGLKEAKELVDGAPALVKEGVATAEAEEIKAKLEEAGASVTLK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_1353 < rplL < rplJ
⊟Regulation[edit | edit source]
- regulator: L10 leader (transcription termination) regulon
L10 leader (RNA) important in Ribosome biogenesis; RegPrecise
⊟Transcription[edit | edit source]
- transcription start sites: 1275001, 1275019 [1]
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_1187 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ 1.0 1.1 1.2 Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)