Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_1596 [new locus tag: SP_RS07865 ]
- pan locus tag?: PNEUPAN001799000
- symbol: SP_1596
- pan gene symbol?: —
- synonym:
- product: IS3-Spn1, hypothetical protein, interruption
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_1596 [new locus tag: SP_RS07865 ]
- symbol: SP_1596
- product: IS3-Spn1, hypothetical protein, interruption
- replicon: chromosome
- strand: -
- coordinates: 1500752..1501006
- length: 255
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (1500752..1501006) NCBI
- BioCyc:
- MicrobesOnline: 117039 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAACTAACTTATGATGATAAAGTTCAGATCTATGAACTTAGAAAACAAGGATATAGC
TTAGAGAAGCTTTCAAATAAATTTGGGATAAACAATTCTAATATTAGGTACATGATTAAA
TTGATTGATCGTTACGGAATAGAGTTCGTCAAAAAAGGAAAAAATCGTTACTATTCTCCT
GATTTAAAACAAGAAATGATTAATCCCAAATCATTCATACCTCTCTCAACTAGATGTAAC
TTACAAAACCCCTGA60
120
180
240
255
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_1596 [new locus tag: SP_RS07865 ]
- symbol: SP_1596
- description: IS3-Spn1, hypothetical protein, interruption
- length: 84
- theoretical pI: 10.1889
- theoretical MW: 10041.6
- GRAVY: -0.80119
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 13)
- TheSEED :
- IS861, transposase (orf1), IS3 family, truncated
- PFAM: HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 20.2)MerR_1; MerR HTH family regulatory protein (PF13411; HMM-score: 17.9)and 6 moreHTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 15.7)HTH_11; HTH domain (PF08279; HMM-score: 13.3)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.1)HTH_psq; helix-turn-helix, Psq domain (PF05225; HMM-score: 12.7)no clan defined Mu-transpos_C; Mu transposase, C-terminal (PF09299; HMM-score: 12.1)HTH (CL0123) FeoC; FeoC like transcriptional regulator (PF09012; HMM-score: 12)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6146
- Cytoplasmic Membrane Score: 0.0031
- Cell wall & surface Score: 0.0051
- Extracellular Score: 0.3772
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011771
- TAT(Tat/SPI): 0.000361
- LIPO(Sec/SPII): 0.000823
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLTYDDKVQIYELRKQGYSLEKLSNKFGINNSNIRYMIKLIDRYGIEFVKKGKNRYYSPDLKQEMINPKSFIPLSTRCNLQNP
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)