Jump to navigation
Jump to search
TIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 31-JAN-2014
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_2154
- pan locus tag?:
- symbol: SP_2154
- pan gene symbol?: —
- synonym:
- product: IS3-Spn1, hypothetical protein, truncation
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_2154
- symbol: SP_2154
- product: IS3-Spn1, hypothetical protein, truncation
- replicon: chromosome
- strand: +
- coordinates: 2068727..2068855
- length: 129
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: AE005672 (2068727..2068855) NCBI
- BioCyc:
- MicrobesOnline: 10348744 MicrobesOnline
- PneumoBrowse for strain D39V:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAAATTGAGTTATGAAGATAAAGTTCAGATCTATGAACTAAGAAAGCAAGGACAAAGC
TTCAAACAGCTTTCAAAAAGATTTGGTGTGGATGTTTCTGGTCTAAAGTCATCTGAATCT
TTGAGATGA60
120
129
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_2154
- symbol: SP_2154
- description: IS3-Spn1, hypothetical protein, truncation
- length: 42
- theoretical pI: 10.3875
- theoretical MW: 4894.59
- GRAVY: -0.814286
⊟Function[edit | edit source]
- TIGRFAM: RNA polymerase sigma factor, SigZ family (TIGR02959; HMM-score: 14.6)Cellular processes Sporulation and germination spore coat assembly protein SafA (TIGR02899; HMM-score: 14.5)
- TheSEED:
- PFAM: HTH (CL0123) HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 26.4)and 4 moreno clan defined DUF2774; Protein of unknown function (DUF2774) (PF11242; HMM-score: 15.3)HTH (CL0123) HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 15.1)no clan defined QLQ; QLQ (PF08880; HMM-score: 14.8)HTH (CL0123) HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 12.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7844
- Cytoplasmic Membrane Score: 0.0035
- Cell wall & surface Score: 0.0028
- Extracellular Score: 0.2093
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.17923
- TAT(Tat/SPI): 0.009208
- LIPO(Sec/SPII): 0.01815
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLSYEDKVQIYELRKQGQSFKQLSKRFGVDVSGLKSSESLR
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V:
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]