Jump to navigation
Jump to search
PangenomeTIGR4
serotype 4
D39serotype 2
D39Vserotype 2
Hungary19A-6serotype 19A
EF3030serotype 19F
670-6Bserotype 6B
6A-10serotype 6A
70585serotype 5
A026serotype 19F
A66serotype 3
AP200serotype 11A
ASP0581serotype 12F
ATCC 49619serotype 19F
ATCC 700669serotype 23F
BM6001serotype 19F
BVJ1JLserotype 1
CGSP14serotype 14
G54serotype 19F
HU-OHserotype 3
Hu15serotype 19A
Hu17serotype 19A
INV104serotype 1
INV200serotype 14
JJAserotype 14
MDRSPN001serotype 19F
NCTC7465serotype 1
NCTC7466serotype 2
NU83127serotype 4
OXC141serotype 3
P1031serotype 1
R6serotype 2
SP49serotype 19A
SPN032672serotype 1
SPN034156serotype 3
SPN034183serotype 3
SPN994038serotype 3
SPN994039serotype 3
SPNA45serotype 3
ST556serotype 19F
TCH8431/19Aserotype 19A
Taiwan19F-14serotype 19F
Xen35serotype 4
gamPNI0373serotype 1
NCBI: 23-APR-2025
⊟Summary[edit | edit source]
- organism: Streptococcus pneumoniae TIGR4
- locus tag: SP_RS00960 [old locus tag: SP_0198 ]
- pan locus tag?: PNEUPAN000926000
- symbol: SP_RS00960
- pan gene symbol?: —
- synonym:
- product: SP_0198 family lipoprotein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SP_RS00960 [old locus tag: SP_0198 ]
- symbol: SP_RS00960
- product: SP_0198 family lipoprotein
- replicon: chromosome
- strand: +
- coordinates: 184617..185075
- length: 459
- essential: unknown
⊟Accession numbers[edit | edit source]
- Location: NC_003028 (184617..185075) NCBI
- BioCyc:
- MicrobesOnline: see SP_0198
- PneumoBrowse for strain D39V: SPV_0184 PneumoBrowse
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAATTAAAAAGATTCACACTTTCTCTTGCTTCTCTAGCAAGTTTTAGTCTCTTAGTA
GCTTGTTCACAAAGAGCTCAACAGGTTCAACAGCCTGTTGCTCAGCAGCAGGTCCAACAA
CCTGCTCAACAGAATACCAATACTGCAAATGCAGGAGGTAACCAAAATCAAGCGGCTCCA
GTACAAAACCAACCTGTTGCTCAACCGACCGATATTGATGGGACTTATACTGGTCAGGAT
GACGGAGACCGTATCACTTTAGTGGTAACTGGAACGACTGGTACATGGACTGAGCTCGAA
TCTGACGGGGATCAGAAAGTCAAACAGGTTACATTGGATTCAGCAAATCAACGCATGATT
ATTGGCGATGATGTCAAAATTTACACTGTAAACGGTAATCAAATCGTCGTAGATGATATG
GATAGAGACCCATCGGACCAAATCGTTTTAACTAAATAA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SP_RS00960 [old locus tag: SP_0198 ]
- symbol: SP_RS00960
- description: SP_0198 family lipoprotein
- length: 152
- theoretical pI: 4.21023
- theoretical MW: 16460.1
- GRAVY: -0.549342
⊟Function[edit | edit source]
- TIGRFAM: Unknown function General Planctomycetes uncharacterized domain TIGR03067 (TIGR03067; HMM-score: 11.5)and 1 moreProtein fate Protein and peptide secretion and trafficking membrane protein insertase, YidC/Oxa1 family, N-terminal domain (TIGR03593; HMM-score: 7.6)
- TheSEED: see SP_0198
- PFAM: Calycin (CL0116) DUF3642; Bacterial lipoprotein (PF12182; HMM-score: 102.1)and 1 moreno clan defined BioT2; Spermatogenesis family BioT2 (PF15368; HMM-score: 10.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Extracellular
- Cytoplasmic Score: 0.24
- Cytoplasmic Membrane Score: 0.05
- Cellwall Score: 0.8
- Extracellular Score: 8.91
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.0004
- Cytoplasmic Membrane Score: 0.4024
- Cell wall & surface Score: 0.0013
- Extracellular Score: 0.596
- SignalP: Signal peptide LIPO(Sec/SPII) length 21 aa
- SP(Sec/SPI): 0.00161
- TAT(Tat/SPI): 0.000109
- LIPO(Sec/SPII): 0.9981
- Cleavage Site: CS pos: 21-22. LVA-CS. Pr: 0.9984
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLKRFTLSLASLASFSLLVACSQRAQQVQQPVAQQQVQQPAQQNTNTANAGGNQNQAAPVQNQPVAQPTDIDGTYTGQDDGDRITLVVTGTTGTWTELESDGDQKVKQVTLDSANQRMIIGDDVKIYTVNGNQIVVDDMDRDPSDQIVLTK
⊟Experimental data[edit | edit source]
- protein localization:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SP_RS00955 > SP_RS00960StringTie [1] : uvrA > SP_RS00925 > spx > SP_RS00935 > SP_RS00940 > ruvX > SP_RS00950 > SP_RS00955 > SP_RS00960 > cls > SP_RS12970 > SP_RS00975 > nrdD > SP_RS12975 > SP_RS00990 > nrdG > SP_RS12610
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription[edit | edit source]
- transcription start site:
⊟Expression data[edit | edit source]
- PneumoExpress for strain D39V: SPV_0184 PneumoExpress
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟'lacZ' fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Indu Warrier, Nikhil Ram-Mohan, Zeyu Zhu, Ariana Hazery, Haley Echlin, Jason Rosch, Michelle M Meyer, Tim van Opijnen
The Transcriptional landscape of Streptococcus pneumoniae TIGR4 reveals a complex operon architecture and abundant riboregulation critical for growth and virulence.
PLoS Pathog: 2018, 14(12);e1007461
[PubMed:30517198] [WorldCat.org] [DOI] (I e)